SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9YZB5_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9YZB5_9CALI
Domain Number 1 Region: 18-134
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.37e-42
Family Caliciviridae-like VP 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9YZB5_9CALI
Sequence length 134
Comment AC=Q9YZB5; DE=SubName: Full=ORF2 protein; Flags: Fragment; GN=Name=ORF2; OS=Norwalk-like virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
AAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQNNVIDPWIRMNFVQAPNGEFTVS
PRNSPGEILLNLELGPELNPFLAHLSRMYNGYAGGVEVQVLLAGNAFTAGKLVFAAIPPH
FPIENLSPGQITMF
Download sequence
Identical sequences Q9YZB5
Q9YZB5_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]