SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YL228_MIMIV from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YL228_MIMIV
Domain Number 1 Region: 34-64,101-130,226-258,343-393
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000615
Family Pseudo ankyrin repeat 0.045
Further Details:      
 
Weak hits

Sequence:  YL228_MIMIV
Domain Number - Region: 231-285,333-370,419-494
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0249
Family Ankyrin repeat 0.019
Further Details:      
 
Domain Number - Region: 471-575
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0327
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YL228_MIMIV
Sequence length 633
Comment AC=Q5UQC5; DE=RecName: Full=Uncharacterized protein L228; GN=OrderedLocusNames=MIMI_L228; OS=Acanthamoeba polyphaga mimivirus (APMV). OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus.
Sequence
MDNLFGKMFYLIKQIGTDQYPMYLIIDRLNIISFLNEKKKTTLTLVEPDYSNPFFKIVKH
NDKQTYLTNYIIKYEQCDLLDISNIDYILDTNKMPQYTCRLFRFFIANDRYDICDYLIHN
RGIKYNYESIPSILHILDDEKEPALLEYIIANIDYFDIDLTFIIRHVLLFFNKDTQYFLD
KINSLAQTKGIEISNKDYCDIANDLIESYDPDIESIKLFLDMGYINGNQIFIIACNFFSD
LVKYLVEQNVNYDINDVLKINVSANILEYFHQKGHVFTDENIRDIMINLTEFEDIEKIKY
MCSEKILCQEHIDSDFLTQLINKNFTNYLEILISEFDIRELIDIDCLMKKAISLDSPEIV
NYCIQNGIDVENYLGLVFEHSSQKLLNMLMASGIEVPEKLSLLGLKSFENMDFVNVYINE
YNYNLPYMFKMTLKNGTLKTFKYVIDTMIQKQQPIPDFVKLLVKYTLDKNMYTQKKNKEI
VNCLINLDIEYNPLQQTLIALIKKDSNRVKNLIHENILYRSLVVLFMTVLTKNIDVLTLL
LEKNTDEKYIKWASIFSVCDYETFRFVIEHTGVDIQRYQEEIILMSGICYNYNNYRYLKL
MGFPDIYTAKKTIDKNGPVKYFVEFMKQYDISV
Download sequence
Identical sequences A0A0G2Y4W0 A0A0U2UHZ8 A0A165XC38 A0A1E1EVM9 E3VZ91 Q5UQC5 W6GEY6
YP_003986724.1.55212 YL228_MIMIV gi|311977604|ref|YP_003986724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]