SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000000098 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000000098
Domain Number 1 Region: 24-161
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.08e-47
Family ets domain 0.0000914
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000000098   Gene: ENSPFOG00000000101   Transcript: ENSPFOT00000000098
Sequence length 527
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519722.1:642409:654638:1 gene:ENSPFOG00000000101 transcript:ENSPFOT00000000098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETSLRAGFAFPEWAYKPESSPGSRQIQLWHFILELLRKQEYNDVIAWQGDYGEFVIKDPD
EVARLWGARKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVLVNYPFIDM
GSSGRGVPQSAPPVPTGGTHFRFPPSTPSEVLSSSEELRSPGVFSTVARRMARGSVSDCS
DGTSTNSELEEAAAADERAIGPDRAFRGLLAPRLPHESLFRFYGGHPTPAGLPRPAPRVH
ADPLSPFPVSPLPGPGGLLSPALSMMGSHFSFNPEDMKHYLQAHTQSVYNYHLSPRAFLH
YPNIVVPQPHRPTPEKPAPHHLQAPPMPLPLSQQQADDAHASPFKFKLQPPPLGRKQREA
GSSLAAAASSSNHASSFTGAGPNVGPAVGGAPPKIKVEPVSDLSEEDVEVTDISEEEEDP
DDDEEVFKTPATPPPGGGGAFPLMGLKTEPGQAVAPVSPGGTRCIPLKLRFKRRWSEDQR
MEADGDREEAEDKKILGLMLPPAPTQRRASSELQRATAQLSLENAGC
Download sequence
Identical sequences A0A087X2U5
ENSPFOP00000000098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]