SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000000114 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000000114
Domain Number 1 Region: 46-175
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-46
Family Regulator of G-protein signaling, RGS 0.00000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000000114   Gene: ENSPFOG00000000132   Transcript: ENSPFOT00000000114
Sequence length 185
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519881.1:71787:79853:1 gene:ENSPFOG00000000132 transcript:ENSPFOT00000000114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPTCFVTRFITMKTRLGCLSKKSDSYSDFSEFLPPAHETTARCLKLSTDEVVRWSESFDH
LLAHKYGLAAFRTFLKSEFSDENIEFWMACEEYKKIKSSTKLVSKANKIFKEFIEVQSPR
EVNIDYRTREKTKQSLSDPTPASLNEVQGKIYSLMEKDSYPRFLRSKMYQDIVNRAHAQG
QRRSV
Download sequence
Identical sequences ENSPFOP00000000114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]