SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000000180 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000000180
Domain Number 1 Region: 53-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-40
Family Regulator of G-protein signaling, RGS 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000000180   Gene: ENSPFOG00000000168   Transcript: ENSPFOT00000000181
Sequence length 206
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519881.1:134318:140717:-1 gene:ENSPFOG00000000168 transcript:ENSPFOT00000000181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKGLATLPATCLKSAKDIKHKISFLLQKPEPQAADQKEIKEKTATAVTKRVPNAAEVEK
WKESFCHVMSSEMGRTVFTSFLKSEFSQENVDFWIACEDYKKTPPSKMATKAKQMYQQYV
EADAPNEVVNLDAATREKTRREIESGGPSCFDEAQKMIYNLMEKDSYRRFLKSKMIQEIC
QKESCAAQEKKGCDWLDSRQVLAGGA
Download sequence
Identical sequences A0A087X327
ENSPFOP00000000180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]