SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000001145 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000001145
Domain Number 1 Region: 2-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.71e-24
Family G proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000001145   Gene: ENSPFOG00000001239   Transcript: ENSPFOT00000001147
Sequence length 291
Comment pep:novel scaffold:PoeFor_5.1.2:KI520001.1:99462:100814:1 gene:ENSPFOG00000001239 transcript:ENSPFOT00000001147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRIVMVGKTGIGKSATGNTILGRPCFESKCSATSMTVDCSKCSSTVDGQPVAVIDTPGLF
DTRFGEDKTRKDLGQCICYAAPGPHIFLVVIAIGRFTAEEKQSVQMIQEIFGEAAERYSM
VLFTRGDDLEGTTIEDYLSGSPDLQYLVSKCNNQYHVFNNRLKDKKPQVTELLEKIRMIV
DRNGGSHYTNEMFQEAERAIEEKKQRIQKKIQEMKEEFKGQREEIEAMRNRLKEEQEREI
QKEKSNLQAVYESRARDEAELFNPLYHLSKAGEHVARACQIINSPQMPPQN
Download sequence
Identical sequences ENSPFOP00000001145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]