SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002158 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002158
Domain Number 1 Region: 146-243
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000169
Family C1 set domains (antibody constant domain-like) 0.078
Further Details:      
 
Domain Number 2 Region: 251-317
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000354
Family I set domains 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000002158
Domain Number - Region: 47-135
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00722
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002158   Gene: ENSPFOG00000002319   Transcript: ENSPFOT00000002162
Sequence length 328
Comment pep:novel scaffold:PoeFor_5.1.2:KI519777.1:665166:667899:1 gene:ENSPFOG00000002319 transcript:ENSPFOT00000002162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TWTCCSSAESHIIKTCNLKTMWLLTVLVFKVLSKFKNNNLWNLRFIQQIEALSGSCLQVP
CSFNSTSNLTRATYALWKSKQKTIFNSRESVNLYPLKIIGNLGEKNCTTLFPDLNSSYTG
DYVLRIENRPFKATAFCHPLQIRWSPSLNISGDLEENQSVTVTCSAFTPCPHSPPELTWN
LQQHSLGQTEKNPDGTFTTKIQETVILSDAHNGYSISCSAGYPVNGGNKTAKAEVTLSVP
YVPRNTRASVSPSSGLVSAGSRVELSCCSRAWPPPSFTWFRISRHGGANVSVGSVYTFNA
KFYCVAANRLGHSRSSVIHVGLRGKYLT
Download sequence
Identical sequences ENSPFOP00000002158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]