SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002244 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002244
Domain Number 1 Region: 262-364
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000621
Family I set domains 0.044
Further Details:      
 
Domain Number 2 Region: 59-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000683
Family V set domains (antibody variable domain-like) 0.079
Further Details:      
 
Domain Number 3 Region: 156-254
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000872
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002244   Gene: ENSPFOG00000002298   Transcript: ENSPFOT00000002248
Sequence length 368
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519676.1:545597:549547:1 gene:ENSPFOG00000002298 transcript:ENSPFOT00000002248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPWAVFCLALLCLELQNGSCQAIKRKKDAVESSAHPGGKRARARQPALTSRKGKSQSLL
TQVLDKGRFLRLGPSTTLTPGKSVELRCKGTNIGWSYPTYLDTFNDSRLSIKHSDKYSQL
VLTSPSAADTGSYSCWVIVCDGTECQRDQDRTYASYVYFTDKENLFVPSAIHFEIVYLRP
DRPAVVPCRVTEPQVEASLHREVPPEEITANQTLLTFDPTKGFILRNPSADLQGVFYCKA
ASKGTPQISTKYQLLYVEVPSGAPFVSLGASPETVRGGDNVNVTCTVLGEPEEDVSFRWS
YPGQLQDRRPVHIQMLWRLVNRGMGHTTRVSQSILSVDNMQTIDFGNYICKAKNINGETI
VTTKIASS
Download sequence
Identical sequences ENSPFOP00000002244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]