SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002355 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002355
Domain Number 1 Region: 38-159
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.5e-45
Family ets domain 0.0000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002355   Gene: ENSPFOG00000002490   Transcript: ENSPFOT00000002359
Sequence length 360
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519669.1:247757:294596:1 gene:ENSPFOG00000002490 transcript:ENSPFOT00000002359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCNCVSDLLLPPVPALWTPGFAFPDWAYKPESSPGSRQIQLWHFILELLQKEEYQGVIA
WQGDYGEFVIKDPDEVARLWGIRKCKPHMNYDKLSRALRYYYNKRILHKTKGKRFTYKFN
FSKVVLVNYPILDMANSPFFLAQNHFNGGSAAPDCSPEAIQSLFPRLPDSGRGTSLFDRG
SAAPGPEGDKLRLDTFPFLGSGESKQTCVPRATPNPLPCWARTPATRPYPWSFNPYLPGA
FSLNNCPKLPPGSLYPSQFYPNPLQSSLSQLPHPFSSLLPPGEAAGGESAGLGLGLGAVS
LGAGTGQQSPTERRGGVKQDPESDSDLEITDLSDCSSDNENEHDFGIGKESSLTQGGRDS
Download sequence
Identical sequences ENSPFOP00000002355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]