SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002580 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002580
Domain Number 1 Region: 368-494
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.2e-49
Family ets domain 0.00000152
Further Details:      
 
Domain Number 2 Region: 31-136
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.36e-34
Family Pointed domain 0.00000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002580   Gene: ENSPFOG00000002665   Transcript: ENSPFOT00000002584
Sequence length 500
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519751.1:755951:780457:-1 gene:ENSPFOG00000002665 transcript:ENSPFOT00000002584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAAVDMKPTLTIIKAEKMDGIVNSCFPDPECGDVPLLTPGSKEMMSQALKATFSGFTKE
QQRLGIPKDPRQWTENHVAEWLAWTINEFSLKNVDFEKFGMNGANLCAMGKERFLDLAPD
FVGDILWEHLEMLQKEDTKHFPINGLTSNFQESRYTSDYFVSYGIEHAQCVPPSEYSEPG
FITESYQTLHPISSEELLTLKYESEYPGIILRDTALNSMQGDYFSVKQEVVSPDNMCVGR
LSRGKLGGQDSFESIDSFESCDRLTQSWSSQSSFSSLQRVPSYDSFDSEDYPTALHGHKP
KGTFKDYVRERSDLSKDKPVIPAAALKERETPFTQVAQVTQIKENKIDFSNNKLVLLIVS
LIIFCLKPWFVCSITIPWMQGIIITWGCSRSGPIQLWQFLLELLTDKSCQSFISWTGDGW
EFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLKSL
LGYTPEELHAMLDVKPDTDE
Download sequence
Identical sequences ENSPFOP00000002580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]