SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002692 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002692
Domain Number 1 Region: 469-697
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-57
Family DBL homology domain (DH-domain) 0.000000543
Further Details:      
 
Domain Number 2 Region: 25-214
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.3e-49
Family Regulator of G-protein signaling, RGS 0.00000295
Further Details:      
 
Domain Number 3 Region: 705-832
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-36
Family Pleckstrin-homology domain (PH domain) 0.0000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002692   Gene: ENSPFOG00000002537   Transcript: ENSPFOT00000002696
Sequence length 1052
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519669.1:321304:346594:1 gene:ENSPFOG00000002537 transcript:ENSPFOT00000002696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIIGAEDEDFESDLADSADDKCPHFDSIDLLKKRPTHLLVFMQHVILQFDPAPLLCYLH
ADIVKNLNARDTKKQFPEFYNNFLEKGAILRVSMPSSLSFELDRTRPELLSDDTQRRYAA
DVQKFQTAEVAKQLEDFRHRQKRMMGMTLCEEQVMDVENHYPTDRVPLDMKEKSVAENLL
EKMFDSQLTFVPDEDKCQAVFSAVAAYMKHLEVKNRAGDSKKSKRGFPWIKSAERKQPFP
VKESKSNQSFPGFFCLCIVSSSDFIKISISSSAVDKDPKGREIKGVSGRGSLTETPVPSA
KKPENTASAPNAEPAGNNLTPTTTEPTPADGNAGLGSLELPSPPDGPLPEIGPGVSVVEH
SSPHDTHPEESDRERRKPSRKVGRSESARVDRHSSRRRGSSRKQSRSRSDVDLQPPSSAT
SPAPLSPQHLHPLDGPAFPSEVPGQPPTSPSPQLEEIDPRLQELEQDPPSWRVLASSDTL
KNLGKKETKRQEVINELFATEHAHVRMLSVLQWVFAKPLEREEILSALDLETIFPSLEEI
IDMHYTFYESLKKLRVSDNYVVKNISPTLLNRFGGPEGEWFQKLTARFCSYQTYALDQIK
QRQKKDARFNAFIQEAESKPQCRRLQLKDIIPTEMQRLTKYPLLLENIAKNTEEKEEKES
IQQSAECCRKILNHVNEEVKTMGNMLTLKEYQKKLDTSGLKASVELYAEYKSIDLTQRKM
LFEGPLVWRVTKEKAIDVHCLLLDDMLVLAQKQEDKMLLKCQSKSNMTAQEGKQMLSPII
KLDSVFLREVATDRKAFYVIFTWDSGAQIYELVAQSVAEMKTWHDIIKSTVDVLKKSGAS
MRLSIPHGVGVTPLSPTTLIAPLNPSENGSLRGSSDQERDSVTGHNAVHPGLKLIEMLTD
RGFVHVLDHSSRNQEKVADGALDEVMSLKRLLIGSISLSEDSQPEEEHEEEQPEKPSDET
EAPQPAEESECTDSGYMQVNASPSTKEDGAKQEDEDGSISAPLVLSQERRDEVCRRLDSL
LQMIQRLQAVEEEHHKLSEVLSEFSLEGANFQ
Download sequence
Identical sequences ENSPFOP00000002692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]