SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002851 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002851
Domain Number 1 Region: 97-169
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.94e-20
Family P4 origin-binding domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002851   Gene: ENSPFOG00000002938   Transcript: ENSPFOT00000002855
Sequence length 1338
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519973.1:253451:273099:-1 gene:ENSPFOG00000002938 transcript:ENSPFOT00000002855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEDPQQPDTGAGSLPGLLPGLQGAEASALQLRIKNSICKTVQSKVENILQDVEKFSDI
EKLYLYLKLPTGPSSSAEKSDQSALSSSRTQQMHAFGWIRDHLEEYPETSLPKQEVYDEY
KSFCDNLNYHPLSAADFGKMMKNVFPNMKARRLGMRGKSKYHCYSGLRKRPFVHMPSLPT
LDLHKSADACDALESSCHVSGIKEEVRFAACDLVCEWAQKVLKRQFDAVEDLARFLIDSH
YISNKSLAALTLMTGAAAAEVKPQQTVSAFAPTAEAQPFQPQGKMFSSPSVDAKQQLQRK
IQRKQQEQKMLSPVLGEEQAKRMLDSVTCGSPSPPSPQPTIGIVVAAVPSPITVQKSGQL
MSPSPVAAVESKVLPINFQMVSQPVQVVKQSPKPAQNNLASPVGERPVRQRYAQILPKPS
ATSGIAMRSPSTMIIANSPIKTVMTTCQVSPVSLVKMTAISLAPTSGETTSLTNTTLRPA
SAGVSSADAGSKQNARSASAVAVLAPITGADTQSMDVEMEVEAIHMNSQMQNPSSQALTQ
EGAASRAGGAVQRAASVPIPHSKGFLGLEETSANTSSGNSSSVKSSSNTANKAGSLLLTS
PNLNTSTLSLANTSRLSSCGESAQAEDGFLSTKSFRKRSGLTSDLSPVKRVFMPQQPAEG
AGYLQGHSSSGRPESAPASRELEMKMSSVFSSQVHVQSSSSLFDSVAKTQSSMQRKNTPR
VMETGDTLMQEQRGHAVGNMHGIPANPSYQNHAGMTSNSAYQCSSANSLQFVNQAASNQL
PMQEHMDYFSFDDDVTQDSIVEELVQMEEQMKLKRLQELGSCGPLQGHAILTPNSVASAS
QRMSGFYQAPSSLIHTSTPTSEVMGGAQALTRDSPFSRIASTTPVDSALGSSRHTPIGTP
HSNCSSTVPPSPVECRNPFAFTPINSSVTCFHDSSPVSSSPVKPMQRPTATHPDKARLEW
MSSSYSSSGGGSNKSNSGMGILTGYRGLTDEPFQKPHAFAVPHARHHDGHCGRLTPISPV
QQQVASMSRQEGFAVPAPLDNKTTCTTFRCRSVSPAVHQRNLSTLPNVPRSVVSPFNSPV
TPEVLSIFANSEANLGVSSLAQRSRSVPLNIMMQTEVQQCSSISSILLSKLEGDHDDALR
GLGVHGVPSAYTARMNLTQMLESNSSRLCGDDTLSLMASESGGSSQQPGYLMENTVNKQT
SLLAGNSQTQPASAEQQQAQSAMLALSSQQQQHLDFRNTQQQHLLTGPLMEQVSELAAGG
ADFPCEIRMASELSGSINDLNSLDTNLLFDPNQQQSRFHSAAAEELNDQLFQQISDAPHS
GGLDWLESKDHPTVGLMG
Download sequence
Identical sequences ENSPFOP00000002851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]