SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000003288 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000003288
Domain Number 1 Region: 427-551
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.83e-25
Family Regulator of G-protein signaling, RGS 0.002
Further Details:      
 
Domain Number 2 Region: 642-776
Classification Level Classification E-value
Superfamily PX domain 3.14e-21
Family PX domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000003288
Domain Number - Region: 383-415
Classification Level Classification E-value
Superfamily ISY1 domain-like 0.0353
Family ISY1 N-terminal domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000003288   Gene: ENSPFOG00000003004   Transcript: ENSPFOT00000003294
Sequence length 983
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519899.1:476777:495003:-1 gene:ENSPFOG00000003004 transcript:ENSPFOT00000003294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTPSTTTTPLAGGSSSRRSSSSSGGEEEPMSASPDSTGGSSFRVVPAFCLGVVAAVAFQ
LAWGGLTLTSVLLKLFIYVSFALLCFLAGSFVLLVRKSPLKVSCFDRNRRESAARLEFFN
RLMGRFSVPAQESVLSRRVVVSHNVDKALKEVFDLAYRDYILSWYVSLSHDEGQLYSMLL
EDWWQMIGQLRSRLADIDVVNVVCYDSVRILHSHFTDLRAASGRRSEEAARPFPLHPCLV
CPDSEMAFLRCVARILLLCLLPQKDAKSHTLRCCLTEVITTKVLKPLVEVLSDPDSINRM
LLSQLEQREQQAEQQKKAYTYAASYEDFIKLISTSTDVNFLKQLRYQIVVEIIHATTISS
LPQLKKQKERKGKESAAMKADLLRARDMKRYINQLTVAKKQCEKRIRMFGGPNYENSEEG
GADDGDEPQSQKILHFDDILCNPGYREHFRAYMERIDKRTLISFWELVEMLKTANKSEVP
QIVGEIYQKFFVESKEIQVEKFLLKEIQESLVGNRGTEVFVRLQEQVAETMRERYYPSFL
VSDLYERLIRRDESNSQSQCSPEEKGNGCQGLDAGEEVCDEGTKGINEQASYAATKLRQL
YDKLEYKRQALGSIQNAPKPDKKIVSKLKEEIGTMEKEHSELQQHITRTDWWCENLGHWR
ASITTAEAAEEGGETVACYSVCVSLTEGEETANSCWSVQRKLTEFQMLHRKLTECFPCLK
KLQLPSLSKLPFKSIDQKFLEKSKTQLNAFLQRLLTDERLCQSEALYAFLSPSPEYLKVM
SVQKKSSFSLASFLERLPGDFFSHTEEDGDDDSDLSDYGDEADGRRNALAEPCFMLIGEI
FELRGMFKWVRKTLIALVQVTFGRTINKQIRDTVNWIFCEQMLVCYISVFRDTFWPNGKL
APHAKVRTDSERSETKERAQQKLLDNIPDALANLVGQQNARFGIIKIFNALQEANANKHL
IYVLMEMLLKELCPELRAAAENS
Download sequence
Identical sequences ENSPFOP00000003288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]