SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000003319 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000003319
Domain Number 1 Region: 1474-1747
Classification Level Classification E-value
Superfamily Cullin homology domain 1.44e-43
Family Cullin homology domain 0.00041
Further Details:      
 
Domain Number 2 Region: 384-458
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.21e-30
Family CPH domain 0.0000372
Further Details:      
 
Domain Number 3 Region: 2143-2199
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000029
Family RING finger domain, C3HC4 0.0035
Further Details:      
 
Domain Number 4 Region: 1984-2071
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000124
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 5 Region: 1767-1861
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000408
Family SCF ubiquitin ligase complex WHB domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000003319
Domain Number - Region: 156-204
Classification Level Classification E-value
Superfamily ARM repeat 0.0443
Family GUN4-associated domain 0.091
Further Details:      
 
Domain Number - Region: 2059-2127
Classification Level Classification E-value
Superfamily RING/U-box 0.0847
Family IBR domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000003319   Gene: ENSPFOG00000003358   Transcript: ENSPFOT00000003325
Sequence length 2391
Comment pep:novel scaffold:PoeFor_5.1.2:KI520295.1:20598:54171:-1 gene:ENSPFOG00000003358 transcript:ENSPFOT00000003325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMVGERRNGNLLVQLGPSLQAYPEELIRQRRTHDGQTEYLIRWCLVTVDDGSRGGSGGST
SGEAKPENILMWMTMEDVFANCPTLLGKRKAEAQRPLQPQEKQLGDVTFDEVELSDMKQD
VKNLVCRARKQMAKKSDFSINIMHTIHVLSAYASIGSLVGVFKETGALNLLMELLCNKET
QTRRSAGKMLRALASHDAGSRAYVLLSLSQQDGIEQHMDFDNRFTLLELFAETTSSEEHG
ISFEGIHLPQIPGKLLFSLVKRYLCVTSLMDKLNTAEGSAHQTELLRLQKEFDFTMAMAN
LISELVRVMGWDRNRKPPDGSGRQPGGGVACSEERAEEVPRPILRSIFQPRFCTSSVSPA
AGSPVSAPAATPTKKRGGNGFKARSDFSSRSAYVEYVQDSLKSGMAVRMLEDYEEVSAGD
EGEFRYSNDGSPPVQVYWNSLSRTYWVHWHMVEILGSGSSSQSDRETQEKASTLTETLKL
TAVSQTFFSKPPGGLYSLPYLTEALQAEPLLLSRAEWWEVLFFIKKLEPKQQQEVHSLLQ
QSLEDQEVQPDDASLIGLSVPGDVSKKLLHYLKQALPSWCLGDLLLLVELRHYLGVAQLF
LGGSQQLAAQQLGLCLQGGDTLLHLLLHLQDRKLQLQPDSSKPFSGQRRMGHQSIIHKIS
STWHLVCKPELSVEKQKFLLMPYKYETETWIISLYRPINSFTGQKLQRTNLVLYQILMSQ
IESVMESLNTTMTLTLTYIFILSTRCGLNKPMALHQYYFTFYLEIVSVYSCHTVSVLIIA
LKFPLISIILSWFIAMSTLVSFLLDLFYRLLTIINLHSSPAAPPNHHVSHHVLIFHCSAS
EFLCHNSHLVRRSVLCPASPVSGFCSMCGAGRLGSVSMGKRQTDINLLKQRKQFRAVLFY
QPRFKPDRLQLRCLNERSLSWCHHVYQSDFLLSFHGSGQLSNGNKTLFNISCCFDVITEL
KKTSVQKYQTKHDLMLHNTVLPSYSKSKLALLLKVIFIIGYYETFLQDNWGSAKLVHVFL
SLLKSGSSKNLVSILYNGILEVRLSKLVNHVKKILMVLRDSNYHRFNNTSLYLLLDFSER
EDFILLCLSHNEETLSGSFGSDGSAVPVLIHSVCHTAAHCAATDTDSILTDIIQPGICVF
LLTSASLRKVLVLRTVENRATARVRIVLGSFSSRNENLADLNISCVLFWSLLLNLVLISI
IISINKCCIYMSVNISIYGALNPWGPDGAPYAIWIKQLLLRRYSCRISDPTGWGTDPICS
SSELKAGQNENSLTPGAVWRLKEFVLFAEVLNRSKELKILKPFAFSFALISLVPMRPGSW
HGSPCWMENTEWVVNLLTRHKRALLTKTKTLQISPRSIQQPCAVCLLDGKEGKNKDSPAA
SSSSSSSSSKPKVKSSSSIAGIALCWQGVVQRQVKKFLESSCSLPDFVERYRSLYLRLKN
AMEELFGQQTAFVLALRHGFSAALLQLSILRAMHVSERFAQYIDQMIQASAAPSGGVETL
ERLQQFLEPMLFLSGLELANTFEHFYRYYLGDRLLAQGNVWLESAVIDQIGSCFPSRFPQ
QMLKNLRESVELQQEFHLYRLQQLDRHLQEQDQVMEDWVESEEEAEVQVLVLSPRCWAVS
SGCFLDEPAKHFPAELCSYLNHFTQFYSHSQSMYSLSHSKPRRLQWTWLGHGELRLGGWT
LHVSTLQMFILLHFNAQEEVRVQQLLQESGLSAAVLLHALQPLIADGGPLTCSSEEEPST
AVLQLNQQVASRSLQGVPASLQLLPRQTYLNVDEDAAGTLERKRNFIYCLIVHIMKQEKE
MHIDNLVFKVMDSCQKQEAARSPGGGRFGCSTGDVLSCIMHVINKGCVRRNDDNPHIVEF
VPEDPATPQKGHAQFSFGRAGSRKDSVADISLVPAPLRFEDGVLDSVLFSMGRTMTQEEV
RQLMQRTVQQVSVTLSLDSDRAEHLLIHCRWNVDLLVQRYTDDPDALIMAAGLTCRNPQP
PSPAPTCPVCLGPRGPDAEPVPTLSCMHYCCRSCWQEYLTARIEQNLVMNCNCPITDCQA
QPTSQFFLGILTDRDTIAKYENALLRGYVECCSNLTWCTNPQGCDQILCKEAVGSMGTCS
RCCWSSCFSCNFPEAHYPASCSHMSQWMDDGGFYEGMSMEAQSKHLAKLISKRCPSCQAQ
IEKNEGCLHMTCAKCNHGFCWRCLKPWKPTHKDYYNCSAMVSKAARQEKKFQDYNERCTF
HHQAKDFAVGLESKVSSINEALQMKSLTFVIDACKVLAQARKVLAYSCVYSYYNQETEKM
DVMEQQTEALDLHTNALQILLEETLLQCTDLASCVRLLKPEHLNTGLELIRRIQERLLAI
LQHSTQDFRVGYQTKSGQEPETTQASSLSNHTDTNKGSKSKSNRGSDSGDS
Download sequence
Identical sequences A0A087XC16
ENSPFOP00000003319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]