SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000003389 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000003389
Domain Number 1 Region: 61-190
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.09e-45
Family Regulator of G-protein signaling, RGS 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000003389   Gene: ENSPFOG00000003493   Transcript: ENSPFOT00000003395
Sequence length 201
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519726.1:1252206:1254465:-1 gene:ENSPFOG00000003493 transcript:ENSPFOT00000003395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRENLRSMSSQNMALPDCMKPTDLSAEHRGIKRKNWRNRIRFLWTNSSKSILHPKKNKSY
RPSVDDVNQWAQSLDKLLGHKYGKAAFHIFLKSEFCEENIEFWTACENFKSLTSQKALTS
KANSIYEEFIKSEAPKEINLDFNTRNAIEQCLCAPTATSFQAAQKKVYSLMENNSYPRFI
HSDLYKELCAVASGNSKLIKC
Download sequence
Identical sequences A0A087XC86
ENSPFOP00000003389 XP_007560637.1.10163 XP_014880215.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]