SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000003398 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000003398
Domain Number 1 Region: 710-938
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-59
Family DBL homology domain (DH-domain) 0.0000000323
Further Details:      
 
Domain Number 2 Region: 318-503
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.86e-57
Family Regulator of G-protein signaling, RGS 0.0000109
Further Details:      
 
Domain Number 3 Region: 941-1075
Classification Level Classification E-value
Superfamily PH domain-like 8.56e-37
Family Pleckstrin-homology domain (PH domain) 0.00000957
Further Details:      
 
Domain Number 4 Region: 49-135
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-18
Family PDZ domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000003398   Gene: ENSPFOG00000003224   Transcript: ENSPFOT00000003404
Sequence length 1324
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519762.1:1365747:1392898:-1 gene:ENSPFOG00000003224 transcript:ENSPFOT00000003404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSREELLDKQTKTQRMGNPLKHEFDPTAVTPSDHRDKKPGISATSRMVKMAGLVQRCVII
QRDKNGFGLTVSGDNPVFVQLVKEDADGAAMRAGVQTGDRIIKVNGTLVTRSNHKEVVKL
IKSGSYVALTVLGRPPGLSQMPLEETQEQEEHEEVSMPLPLSTPNSPALSGAERSSFLNL
LMFQEGTSGSRIRDEDERDDGTLLKEQTGEEVSPTNSSAVSTAFNWKYLKCLSSSNFTHS
TPVPEASGKRESPLQSPDVSRQDDLNFCSSPDTEDAPDTDSSPHSSVASPPYTLNPQIIG
AEDDYFDYQQEQINGECSCFQSIDLLKSRPAHLAVFLHHVVSQFEAAPLLCYLYAEMHKQ
TSSKESRRFFMEFHSLFLDRTSNLKVPVPETIASELEKRRLELIPEDLCKQYTQVLQDSL
LSDLLKNLEDFRQKRSMGLTLAEDELSKLDLERGKDQPALEKECACAEHILAKIEDILQA
SEEEKCQAMQYVILTYMKHLGVKVKEPRGLEQKRARITFLPKIKRGSKPEKDGDWKKPRF
PNILVPPRRLSKVDSTLVVKSVELNKQRSPKFSQPAFVIPEPADHPASNPGRSRANQLSQ
GSDTSTQSTISVASLGPSSADLTGQETDSSVSPFCIQSRLSDGLQAGEHQDGLSSPISTQ
FDFSPSGLDHREDDQDAFSRMEIQPTVGSADFQSEDDHAGEVESEEDPLNWQKLVPRGVL
ASLTSKEINRQEVINELFITERAHLRKLRVLDGVFCQRLSRHGVLPPDDIKRIFINLEEI
IQLHFSITEQMAAVRKRSETSVIGQIGDDLLAWFSEEEEEKIKKATGTFCSNQPYALELI
KTRQKKNQRFNLFMQEAESNRLCRRLQLKDIIPVEMQRMTKYPLLLDNIAQYTEDGEEKE
KVKKAGETCKKILNHVNQAVKEAENKQQRLVDYQRRLDVSSLKQIENPMILELRNLDLTK
REMVYEGPLSWKVNKDKTIELYTLLLEDIMVLLQKQDERLVLKFHGKNLTSIPDAKHSFS
PVIKLSTVLVRPVATDNKAFFVLSMSENGVQMYELMAQKVSDRRTWQCLITQCADAMKAK
AHPSDRPPAQAEAERVAVEILNQEMPKQSETLTETIHSADKDAPCSPDVQSPINPFDGLK
SEDEEEELPATVRQEENGEEEEVDEVEDMESNFPSSKAEEALRTLAMLKETLYSHMMSRE
VEKETEENKPSSAGPENNDLQLCSGLTGVSESAQPNGGFAGLDFEAGSGESSTDDDVAID
MRKLLSSSSQAGGDGPDLSRQLMTHLRLLQADLQYLQEVEMKYNELQQIHNNRSTDSDDN
NDKE
Download sequence
Identical sequences ENSPFOP00000003398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]