SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000003499 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000003499
Domain Number 1 Region: 56-182
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.77e-41
Family Regulator of G-protein signaling, RGS 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000003499   Gene: ENSPFOG00000003657   Transcript: ENSPFOT00000003505
Sequence length 190
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519726.1:1277869:1280548:-1 gene:ENSPFOG00000003657 transcript:ENSPFOT00000003505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKLLFSKIRFSDIKDLFPNVQRPRRIDIVLNRRRRNCNIWSSGQKLNDEACPSNLSWKT
DHKLDLSLEKWLKDKRYRAAFRSFLESEFSEENIDFWLACEDFRSASDDLKWRAEKIYEE
FVKPTACREINVDHSVREKIQESLEKPSHCCFDEAQKHVYLLMLRDSCPRFLHSDAYLSL
KRKSRTHWYI
Download sequence
Identical sequences A0A087XCJ6
XP_007560639.1.10163 XP_014844497.1.96476 ENSPFOP00000003499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]