SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000003597 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000003597
Domain Number 1 Region: 270-368
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.46e-35
Family ets domain 0.0000878
Further Details:      
 
Domain Number 2 Region: 45-125
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.42e-17
Family Pointed domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000003597   Gene: ENSPFOG00000003692   Transcript: ENSPFOT00000003604
Sequence length 382
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519857.1:442972:447173:-1 gene:ENSPFOG00000003692 transcript:ENSPFOT00000003604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPCLSSILTNANLTMYQTGLPDIPPQQLHALPTIHTLESRSYNTRGHWYKQISPHQWT
AEHVLEWISDHVERTKFDASTLSLDFCSIDGPNLCRMNQEEMTAVFGPQLGPHLYQSLEE
YKTKYELQSLSGPELSETCQLLDNFLDNLSFPLLTTLKIGHGEETEIKRNFAYRDGYDLT
RFTMESLTTLDDTDYLSDNPSDSECSSSANSGKFRFMSSPESGSSESDPEFYPVSKVHIK
TEDGDCRIKRPRGRPPKVNRGHSSSIYDNPKKNKHAPRGTHLWEFIRDILIHPEKNQGLM
KWEDRREGVFKFLKSEAVAQMWGQKKKNTSMTYEKLSRAMRYYYKREILERVDGRRLVYK
FGKNSSGWKTEEIGSGIGGVSL
Download sequence
Identical sequences A0A087XCU4
XP_007569899.1.10163 ENSPFOP00000003597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]