SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000004566 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000004566
Domain Number 1 Region: 118-201
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.8e-30
Family Forkhead DNA-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000004566   Gene: ENSPFOG00000004698   Transcript: ENSPFOT00000004574
Sequence length 499
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519632.1:824359:830412:-1 gene:ENSPFOG00000004698 transcript:ENSPFOT00000004574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKHWPEQTLLAPAALCHSGEHRDHQLDIYRNVQRRVPSCGLAQQRPQQPAEMTPSARTE
HRGGATGLADQTIPAHSSYQDGDDANAKLRDVTRETWRAEREKSGSSSGKKKNYQRYPKP
PYSYLAMIAMVIQRSPEKKLTLSEILKEISTLFPFFKGNYKGWRDSVRHNLSSYNCFVKV
LKDPGKPQGKGNFWAVDLNRIPLDLLKRQNTAVSRQDETIFAQDLAPYILQGHKPESEPP
PPPPTERVTSLPPVSSGNPSPPSQDNLFRPKLDSSFAIDSLLHSLRPTSASGHVDRDGWG
EVERPRPSPPPGSRYTSSASSVSPASTSSTSSDEEWKGLSHTGKRVPPNGEAGSDGYEDL
RPPLHKSARRETVAPPWELPTSYAKYAPPNAVAPPSMRFNGGPVMPLHGGLPLYSYGSSP
MAPSHFIGHSYWPILPSRRVSVQPPPLLMDLDNMLQSVPPNKSVFDALLPTNQNAYSHHQ
PQSQYPLQNGTPLNKYHQY
Download sequence
Identical sequences ENSPFOP00000004566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]