SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000004844 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000004844
Domain Number 1 Region: 109-394
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-77
Family Protein kinases, catalytic subunit 0.0000143
Further Details:      
 
Domain Number 2 Region: 32-104
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-21
Family SH3-domain 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000004844
Domain Number - Region: 409-479
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00494
Family Regulator of G-protein signaling, RGS 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000004844   Gene: ENSPFOG00000004712   Transcript: ENSPFOT00000004853
Sequence length 1023
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520049.1:160061:185464:-1 gene:ENSPFOG00000004712 transcript:ENSPFOT00000004853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSQAASPNGEGRPGGGGTGEHAWTECPTVRSWAHSAPLCPTRSLWTAAYDYEASGEDE
LSLRRGDVVEVLSKDAAISGDEGWWTGKLNHRVGIFPSNYVTYQPAIYRIPATSGSAGVS
EQVPSSPTQIPFSELVLEEIIGVGGFGKVYRGTWKDQEVAVKAARQDPDEDITATAASVK
QEAKLFSMLQHPNIIKLEGVCLEEPNLCLVMEYARGGTLNRALTGRRIPPHILVNWAVQI
ARGMLYLHEEAVVPIIHRDLKSTNFLLLEKIENDDIGRKTLKITDFGLAREWHKTTKMSA
AGTYSWMAPEVIKSSLFSKGSDVWSYGVLLWELLTGEVPYRGIDGLAVAYGVAVNKLTLP
IPSTCPEPFAKLMEECWDQDPHVRPSFSCILEQLSAIEEAVMATMPQDSFHSMQDDWRVE
IQEMFDELRTKEKELRSREEELTRAALQQKSQEELLKRREQQLAEREINVLERELNILIF
QLNKDKPNVKKRKGKFKRSRLKLKDGNRISLPSDFQHKITVQASPSMDKRRSLHSTSSSP
PSSPTLIPRLRAIQLTQDESNRTWGRSSLFRPEEFDDVKKGIKKKGRTWGPSSVQSKERP
AAAERVRPLSDGSNPWSTSLLKSQKSVPLAALFGEQVGAGREEAFPQECPDSSSKPKQLK
FPNQVYIDLPLWKDETQPQSPGGSGGPGDAGVGAGSPPETPEDPCTTTSTSSTSTTPQLT
PTNSLKRASARRKTDFALYGCGSLLASVVLGYDIREAIRTSAPPEECETPKEEKKKKEGL
FQRATRFRRSTSPPGGRSRKEDASSNGGAAPPVNLVSMSAIMECNSTKCLLQPEAEASEL
NPGKAEPAVNDDNSETSRPVRAAAADSQSSKPAAETQKAEQSQSRPPEQSNHNTGTRLRR
KKYTANHNTHNGPPAPPAAQRKQEKEEKPANGDAVPRQRPVSFRAKPHAWALLRGRNKSY
SLGHYSGEKTAQDLSVVLSSEVGCSLLDMDTEGQKRDCTVPLCRIQSSPARPSMFELEKE
FFS
Download sequence
Identical sequences ENSPFOP00000004844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]