SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000004957 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000004957
Domain Number 1 Region: 93-225
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.62e-45
Family Regulator of G-protein signaling, RGS 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000004957   Gene: ENSPFOG00000005013   Transcript: ENSPFOT00000004966
Sequence length 233
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519637.1:566849:588383:1 gene:ENSPFOG00000005013 transcript:ENSPFOT00000004966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCLEPMGSERMEMRKRQMSVQQESAAGGTAPAQQDQPSQANPRGSNACCFCWCCCCSCS
WLKCVTFKNEDRDERNRKASYDVKEGTSDCEDCPNPTLEDVRTWGQSFDKLMCCPAGRNS
FRQFLRTEFSEENMLFWLACEEFSKETNKSVIEEKARLIYEDYISILSPKEVSLDSRVRE
AINRNMPEPNLHTFDDAQLQIYTLMQRDSYPRYLNSLAYKNLLKPLSEQSPES
Download sequence
Identical sequences ENSPFOP00000004957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]