SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005259 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005259
Domain Number 1 Region: 225-307
Classification Level Classification E-value
Superfamily ClpS-like 4.03e-16
Family Adaptor protein ClpS (YljA) 0.029
Further Details:      
 
Domain Number 2 Region: 778-861
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000707
Family ELL N2 domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005259   Gene: ENSPFOG00000003667   Transcript: ENSPFOT00000005268
Sequence length 1757
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520295.1:72398:91642:-1 gene:ENSPFOG00000003667 transcript:ENSPFOT00000005268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPSRDPPSALSADFMSFSPGDTASRWLACADLQQEVYCHLAEYVPRILCQGGGMAEHR
EEQREEQREELALQLLLLAPLEWFLPAAGLALLQQGGGAAALCGHVFKVGEPTYSCRECA
ADPTCVLCMQCFLASAHRHHRYRMTTSGGGGFCDCGDAEAWKTGPSCQNHTPADQNRETE
EDPVSLLPPAVEERSCSIFSIILQYAVDLLTWEQEDQLPAGLEPPQRSDSYYCMLFNDEV
HTYEQVIYTLQKAVNCSQKEAVSFATTVDRDGRKSVRFGDHQFCEQAKAVIVRSTSRQSK
PLRVQVMHSALVAHQCFALKALGWLGQIIQYSDGLRRILCQVGLRPGPEGENSSLVDRLM
LNDSKMWKGARNVYHQLLMNSLLMDRKFKKLFAIRFAKNYRRLQTDFMEDDHDRLVSVTA
LSVQLFTVPTLARMLMVEENLMMTIIRTFVDQLRHRDAQGRFQFDRYTAQQAFKFGRVQS
LIGDLKYVLISPPPQWSQQLRTKFLDGFETFLDLLRCMQGMDPVVRQVGQHIEMEPEWEA
AFTLQMKLTHIITMMQEWCSTDEHVLIEAYKKCLSALSQCQGGLPDGEQPISLSLAGHTV
DTFRYQVSQEKVSIHLPVCRLLAGLHVLLSKTEVASRLPEQLPLGELSPHLLIELPLRCL
VLCAQVHAGMWRRNGFSLINQIYYYHNVKCRVEMFDKDLAMLQVGASMMDPNHFLMIVLS
RFELFHTFSAADLRRRYREANKDLAQQNTLIEEMLHLIIMVVGERYVPGVGQVELLDEVR
REILHQLCIRPMAHSELVKALPENGNKETGLERVIDSVASFRKPGVTGRGLYELRPEWSK
RFDLYFHHYSRADQSKAEEAQRNLRRQNGEDTDSPGHHGNLCCLFGSLVNLLQCDALLAL
EGAVLQWAVEPSGGGWTESMLQRVLHLVAMALLEEQQQLESSGADEDVSFTFSTRITRPG
EAPSTSGSVLALLESLQNAPHLEVHKDMITWILKMVGNIKTTRERTSGSSVSVSHGRRPE
ESVRDKDKAERKRKAEMARLRREKVMAQMSEMQKHFINENKELFQQSMEDLEAAATATEH
SPPSLEPTCVAHICVGPMRVGGAERRQLVTCILCQEEQEVRGHGRAMVLAAFIQRSTVLS
KNRSRGIPDPERLDPLFMHPDLSVGVHTASCGHIMHATCWQRYFEAVQQKEQRRQQRLRG
HTSYDVENGEFLCPLCECLSNTVIPLLPHACSPDRSVEHPCLETWLKRTNQQAAALGFTH
RKQSHGAAQQVEPAVPDRFRVGFDPQNSFSSGVGEMINTFSMSAYKVGLKVNPNEQDPRV
PVLSWSTCAYTLQSTERLLMDEKKPLFGSLPCRQDDCLSSLTRFSSACWTAAPIRTVQNH
FIRLWFLSGPVLVPIPDSQLEDAPCILDVDMFHLLVYSVLSYSSLHSLDQSGRRSVDSAH
LHLLHLVTVAHLVQVLLTFTTGELSMDQDGEESEEEQLTCQLYGRLRDHLGRCLPDISCG
WRLWRCVRASVLPFLRTAALFFHYMNSASPPADLLAAGTGPGQWEALCSYLSLPSNLLLL
YQNQRTLLEPLIHRWCCHPGVGQVLHGGGVLVRFPRESNRLIDLPEDYSILINQASSFTC
PRSGGDKSRAPTLCLVCGCMLCSQSYCCQTEVEGEDVGACTAHTFTCGAGIGLFLSRVRE
SQVLFVAGKTKGCFYPPPYLDDYGETDPGLKRGNPLHLCSERYQKIERLWRQHGIAEVIG
HAQEANQTLVAIDWQHL
Download sequence
Identical sequences ENSPFOP00000005259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]