SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005379 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005379
Domain Number 1 Region: 4-172
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.39e-59
Family G proteins 0.0000000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005379   Gene: ENSPFOG00000005479   Transcript: ENSPFOT00000005388
Sequence length 203
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519909.1:421234:427025:-1 gene:ENSPFOG00000005479 transcript:ENSPFOT00000005388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMEDYDYLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKL
QIWDTAGQERFRSITQSYYRSANALILTYDITCEDSFRCLPEWLKEIEQYANNQVVTILV
GNKIDLADKREVLRQRAEDFAQAQSMLYLETSAKESDNVEKLFLDLACELIREAKQNKLD
NNDTAPMPGEGKTISYLNCCSLN
Download sequence
Identical sequences A0A087XHX6 A0A0S7JI42 M3ZZ56
ENSXMAP00000007500 ENSXMAP00000007500 ENSPFOP00000005379 XP_005796893.1.87360 XP_007572436.1.10163 XP_012730706.1.37407 XP_012730707.1.37407 XP_014836496.1.96476 XP_014885918.1.100837 XP_014885919.1.100837 XP_017163882.1.1237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]