SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005614 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005614
Domain Number 1 Region: 153-378,421-470
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.02e-48
Family Glycerol-3-phosphate transporter 0.036
Further Details:      
 
Domain Number 2 Region: 589-738
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.72e-17
Family Glycerol-3-phosphate transporter 0.047
Further Details:      
 
Domain Number 3 Region: 494-575
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000157
Family Pentapeptide repeats 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005614   Gene: ENSPFOG00000005638   Transcript: ENSPFOT00000005623
Sequence length 741
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519896.1:667631:686624:-1 gene:ENSPFOG00000005638 transcript:ENSPFOT00000005623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKMEDGYQNRTAFIKGAKDIAKEVKRQASKKVGRSVDRMSDEYSKRSYSRFEEDDDDYPM
QGSQEGGYYRSDSQAANDDEGGHSDSTEGHDEDDEIYEGEYQGIPRADSGKGDLAGGPGS
ITAGAQQFKDVGASEAARRKDQEELAQQYETILQECGHGKFQWTLYFVLGLALMADGVEI
FVVGFVLPSAEKDMCLSEPSKSMLGLIVYFGMMVGAFLWGAMADRIGRRQSLIISLSINS
IFSFFSSFVQGYSTFLFCRLLSGVGIGGSIPIVFSYYSEFLSQEKRGEHLSWLCMFWMIG
GIYASAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVAAIAALNAMPESPRFYLE
NGKHDEGWMILKQVHDTNMRAKGYPEKVFTVTTIKTVKQVDELVDIGTDTPVWQRYRLKI
MSLSQQIRKNILACFSPEYKRTTFMLMAVWFSMSFSYYGLTVWFPDMIKYIQKQEYESRT
KTFTKERVEHVTFNFTLENQVHRDGYYFNAKFLSLKMKSMVFEDSVFEECYFEDVTSTHT
FFRNCTFIASLFYNTDLFKYRFINCKLINSTFLHNKEGCMLDFSDDFNNAYMIYFVNFLG
TLAVLPGNIVSALLMDKIGRLRMLASPAGSSIISCVSCFFLMFGNSESGMIALLCLFGGI
SIASWNALDVITVELYPSDKRTTAFGFLNALCKLAAVLGISIFQSFVGITKAVPILFAGG
ALAAGSFLATKLPETRGQVLQ
Download sequence
Identical sequences ENSPFOP00000005614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]