SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005840 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005840
Domain Number 1 Region: 671-794
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.24e-37
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 989-1083
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.39e-28
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 18-99
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-20
Family PDZ domain 0.0054
Further Details:      
 
Domain Number 4 Region: 200-314
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000115
Family Phosphotyrosine-binding domain (PTB) 0.035
Further Details:      
 
Domain Number 5 Region: 935-1003
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000723
Family UBX domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005840   Gene: ENSPFOG00000005636   Transcript: ENSPFOT00000005849
Sequence length 1442
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519651.1:87561:133529:1 gene:ENSPFOG00000005636 transcript:ENSPFOT00000005849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQGQPEGARRRLDMNATGELRDVEVIRGRAGYGFTITGQKPCLLSGIMEGSPAFVVGLRQ
GDRIMAINGADVSAASHETVVQLIGGCKGPLHMVVLSERRIMGNPILNDAKFGFEQKSSV
FQKPGVLRAVSHDPSRPSFDPNNGVTAKQRPVSEPDMSLWTQQFNVLSGKKKEETPTVKD
TDSVFSDTEEVNPDWSVLNMTLVVGYLSSTELILNTGDTEDDCLKAIRERIRQLGTEQDT
HTLVMMKVMFDCIRLCDDAGAVLAAFPAENLVLGAVCAEDPRFFCLVTTAHIINGRVPDD
GPLRASCHVFFIDPDLGNHKDHIGIACRFGFNCTPDPDSLGCLEFPQTPPDVLHFVTVLY
SDLGEAVERLRAKLDMEAQQTDSTSKLGSASSNGDSGIENSSPPEERADRDFPSDIPNLS
GTHLPSCPWDYPSTEVVTPVNPVKNGQKLEPENSASPHSLSESLPGPDSLTSFYGGPPPR
LEFHFKPPPPPLPLSKKPNFLAYPLRSSQRWFSKPKWPKTLSSDSVNQETSTNINSTTNN
PPSALNQAHSDRYHSTEAMMPPREEWTKRFLEQRQKQRADGSYRNSKVLDRFGFKLHGSR
FWGIGVTRASKRRSSKRLSMARSLDDLESAASSDGDYSGIQLQGCCSHSSLTSNGSLPGA
GGHRGSADHRVAGWSTCFERLLQDPVGVRYFSEFLKKEFSEENILFWQACEYFSHVPATD
KKQLSQRAGEIYNSFLSSKATMPVNIDSQAQLADDVLTSPQPEMFKTQQLQIFNLMKFDS
YSRFLKSSLYLECLRAEEDGQPLPDPYQIPCSPAPSKHSASSDRSTLSTPKKVDTQDIRK
QRSGKSLNEDTKDESADKKRGIFFSWSRNRSFGKGPKKKDIGDINLDFWGSNGRRESQGS
LSSSASLEIPNSVSAAKMESDNRHSVGAWERSSRHCSVLLPDSSCSSITLRPGASIREVL
QDLCRNICVNIAAVDLFLVGGEKPLVLDQDCMTLCSRDLRLEKRTLFRLDLVPINRSVGL
KAKPTKPVTEVLRPVVAKYGLNLGDLVAKISGETEPLDLGAPISSLDGLRVVLEQADPCS
GKDKKINILLSKLVAKDTNATEFEPGEVKTMSFYYILHLQGDERSAPKDISVRAAGPASA
LPGEKRKQKKINIDEAEEFFELLSRAQSTRANDQRGLLKKEDLVLPDFLRLTPPTSSCSA
SSNLACSTPASLKPSRENGVPPRGSLTAALRSESLDSSLSSSANGHSASRRCLLRPSLRT
VEEDAHADLTLVGEGDISSPNSTLLPPSPPSFPSLESSLPEANFTPPTPCPPSQDTGGEG
KSSSGISTNQTYCDKLSATRCEENCKRSSERRKETPHGTKSPADRADAAQEVMDVEGVHL
EEARNVEASLGDDSELSLSFQGYVAELRQCQSKMRSAQMPQDVRNPTEGKDCQSDLYKAT
IV
Download sequence
Identical sequences ENSPFOP00000005840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]