SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005895 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005895
Domain Number 1 Region: 58-199
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-40
Family Regulator of G-protein signaling, RGS 0.0000935
Further Details:      
 
Domain Number 2 Region: 362-452
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-25
Family Ras-binding domain, RBD 0.005
Further Details:      
 
Domain Number 3 Region: 307-376
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.07e-16
Family Ras-binding domain, RBD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005895   Gene: ENSPFOG00000005903   Transcript: ENSPFOT00000005904
Sequence length 598
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519636.1:1025705:1038699:1 gene:ENSPFOG00000005903 transcript:ENSPFOT00000005904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSGFFHKFSRLAKSVSLKQHEKLHILSRCNREGRKSQAVSDGELNMTARGCGGSSSS
LPGTPGGDVNSANSVLSWAVSFEKLLEDPHGVSYFTAFLKSEVSAENILFWQECEKFRKI
PATSLDRLKAAARSIYDTYLSDCAPYSVNIDDTAKTEEKDLEQPTPDMFSKAQAQIFKLM
KMDSYRRFVRSPLYQRCTLASVEGKFLPQLSTEPVRMGSWDDMANKSPSSDKKNRKSDSN
SLPSGKSVSEKQRQKRGSWGQSNMSIKSTSSVELGSLCRQMENGWPGPTSRDQAAGIVSR
MGMEGGYCCVYLPDGSASLAPTRNGQPIKDMLASLCEKRGFPLKDVMIYLHGKDKQPLSL
DQDCSVLRDQQVSLELRVTFALENAFTGKTVGIMAKSSKTLQDALCSVMQKHNLKPQETV
VTMVGSDVPVNLNCSVYKLANKTLRLEKAKGKDQAIISRGGSSPNAQPGAGSGGLEPQLS
TQTDRVRTQHRPSKNRDMDGFLDMLTRAQCCRVDDQRGLLTKEQLEIPSFLQLSSDQGQN
TDDSSATSSSTTDSKPESGDNSDAPDPAPVPDPAPANKSEESSAAPKSESKDLRETTV
Download sequence
Identical sequences ENSPFOP00000005895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]