SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006437 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006437
Domain Number 1 Region: 20-147
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-29
Family V set domains (antibody variable domain-like) 0.0018
Further Details:      
 
Domain Number 2 Region: 105-228
Classification Level Classification E-value
Superfamily Immunoglobulin 5.72e-19
Family C1 set domains (antibody constant domain-like) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006437   Gene: ENSPFOG00000006498   Transcript: ENSPFOT00000006448
Sequence length 243
Comment pep:novel scaffold:PoeFor_5.1.2:KI519688.1:601053:604387:1 gene:ENSPFOG00000006498 transcript:ENSPFOT00000006448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGTLCTLITALTCVSGATVVTQTPPVVTVRKGETATMDCNLGTVDNTAYWYKQIPAGVP
QWVLYFYRTNGSPSYGSGFSSPKFTSTHQSSTGYRLIINNVEERDSAVYYCKTWDSSVNE
YVFGPGTKLIVTGSSLPPPVLTVFPPSKAELQSNKATLLCLSSLSSESKGFADVSWLVDG
SPVSSGISTSTAVQRPDQTFHISSSLSIQTSDWNMNKVYACKVSLGSQAAEKTINKSGCP
AEE
Download sequence
Identical sequences ENSPFOP00000006437 XP_016529041.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]