SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006609 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006609
Domain Number 1 Region: 23-201
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.72e-62
Family MHC antigen-recognition domain 0.0000683
Further Details:      
 
Domain Number 2 Region: 199-298
Classification Level Classification E-value
Superfamily Immunoglobulin 5.66e-23
Family C1 set domains (antibody constant domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006609   Gene: ENSPFOG00000006404   Transcript: ENSPFOT00000006621
Sequence length 359
Comment pep:novel scaffold:PoeFor_5.1.2:KI519768.1:546301:560969:-1 gene:ENSPFOG00000006404 transcript:ENSPFOT00000006621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQIAIMNCFGLLLLFHVASSVKHSLRYFLTATHGVHDFPEFFGAATVDEVQVGYCDSNIK
TAKPKQDWMMKLIERNPEHLEWYSQKCLGSQHVFRANIDILKQRLNLTKGPHILQRMNGC
EWDDETGEVIGFNQYGYNGEDFLALDLKTLTWTAPKSQAVLTKLIWDGEKARLEHNKNYY
IYKCPDWLKNYIRHGKSFLQRTVHPSVSLLQKTPSSVVTCHATGFYPERATMFWRKDGQE
LHEGVEKGEILPNNDGTFQMSVDLNISSVTAEDWRRYDCIFLFAGLKDSITTRLDRTMIR
TNQDESSQIRIVIAVISVVIAIIIIAVAFTAYKKRNGKSTLKLDSSSNLIKYKLNKINL
Download sequence
Identical sequences ENSPFOP00000006609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]