SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006683 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006683
Domain Number 1 Region: 429-535
Classification Level Classification E-value
Superfamily occludin/ELL-like 2.09e-33
Family Occludin/ELL domain 0.00075
Further Details:      
 
Domain Number 2 Region: 129-218
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.26e-26
Family ELL N2 domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006683   Gene: ENSPFOG00000006748   Transcript: ENSPFOT00000006695
Sequence length 540
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519801.1:572234:580567:1 gene:ENSPFOG00000006748 transcript:ENSPFOT00000006695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YIKIPAPTTESPDGFRVFSFYLSSDSKDKPQSSFDCIHQFISGEGRDHLESKGSIQDKIT
VCATDDSYQTTRERMSQVEKDIWSRTAIEIKPGPSKCVKVQRKQGLVSSSDSSNKHSPSN
KRPLLPSPVAHRPLRDRIIHLLALKPYRKPDMLLWLERERASPKDKADLTSVLEEVGKLN
PKDSSYSLKDELYKLVQRDWPGYLEEEKQLIHRLLIRKLQPLHNNQSRSPQSIHSLHKTL
GDSPSRLSPAKNLSVKRSLVLDASSIQTPKKQKLSEHCLPLQSPSHADCGTNGARNSSSH
GNSSAATKTEFDITNNHLQGNPVGLYSPHKLSMPCAISKLEKTEPAPILPSPKPRHNGTS
ICTKQQLANGQHKKKRSKKHKDKERDRLKPDWIETSPDMKQNQENVKATDHERDKTPVNR
ASTEELPDYFIKYSTVTTLEQRQLYHDDFCAEYDEYRVLHDRIGAITEMFVQLGSKINTL
TPGTQEYKLMEDQILQKYRKYKKKFPGYREEKKRCEYLHKKLSHIKGLIAEYDRTQGLVS
Download sequence
Identical sequences A0A087XLN0
ENSPFOP00000006683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]