SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000007004 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000007004
Domain Number 1 Region: 31-385
Classification Level Classification E-value
Superfamily Cullin repeat-like 4.71e-114
Family Cullin repeat 0.00000168
Further Details:      
 
Domain Number 2 Region: 377-675
Classification Level Classification E-value
Superfamily Cullin homology domain 8.63e-94
Family Cullin homology domain 0.000000344
Further Details:      
 
Domain Number 3 Region: 680-768
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.68e-29
Family SCF ubiquitin ligase complex WHB domain 0.00000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000007004   Gene: ENSPFOG00000006984   Transcript: ENSPFOT00000007016
Sequence length 768
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519825.1:720500:735897:1 gene:ENSPFOG00000006984 transcript:ENSPFOT00000007016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIMSNLKGGTKKDTKMRIRAFPMTMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRN
AYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIR
DILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDR
GAIRNACQMLMILGLDGRSVYEEDFECPFLDMSAEFFQMESQKFLAENSASVYIKKVEAR
INEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMY
KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKTRFDHFLLESF
SSDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLFR
FMQEKDVFERYYKQHLGRRLLSNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSIS
NSTMDEFRQYIQSISASLSGVDLTVRVLTTGYWPTQSATPKCTIPPAPRDAYEVFRRFYL
AKHSGRQLTLQHHMGGADLNATFYGAIKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMT
ILMLFNNREKCTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHVFT
VNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHN
VLVAEVTQQLRARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
Download sequence
Identical sequences ENSPFOP00000007004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]