SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000007005 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000007005
Domain Number 1 Region: 339-527
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.27e-62
Family Regulator of G-protein signaling, RGS 0.00000856
Further Details:      
 
Domain Number 2 Region: 730-958
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-59
Family DBL homology domain (DH-domain) 0.0000000212
Further Details:      
 
Domain Number 3 Region: 959-1094
Classification Level Classification E-value
Superfamily PH domain-like 4.07e-38
Family Pleckstrin-homology domain (PH domain) 0.00000693
Further Details:      
 
Domain Number 4 Region: 33-125
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-22
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000007005   Gene: ENSPFOG00000006850   Transcript: ENSPFOT00000007017
Sequence length 1391
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519641.1:1136749:1166034:1 gene:ENSPFOG00000006850 transcript:ENSPFOT00000007017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHLCPSFLRTSSILSKDHPPDKKPKSDKASLSSNEFDPTGLVQRCVIIQKDENGFGLTV
SGDNPVFVQLVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHTEVVKLIKFLAGSYVALTV
LGRPPGLAQIPLPEAEPDILGVSLSSPNSPATERPYSPQDRLSPFQPSWDYLFYVPEAMK
EEYSRNPSPKLLKDIQEAKKHIPQLQGQLLKSTETTQEAVSGGDADDSSTYETDRALTPK
ADSSTDLSWSSTPVSTIFRPATPESHCPKELSYPSPKSTPRNSFNSCHSPETEDTTDLDS
LSPPALSSPSSSRVISQIIGAEDDYFGRDQEQTNGQCDSFNSIEQLKSRPAHLAAFLHYV
ISQFEPAPVLCYLYTELYKQTNSKETRRVFMDLHTFFMDRGANLKVPVPESVSSDLEDRR
RTELIPEEINRQHVQTLQDSLLADVEKHLEDFRQKRNMGLTVAEAELARLDQERVRDRVT
LERERSYAENIISKIDDVLLTTQTTEEDKCSTIQFVIYTYMKHLGVRVKEPRNLESKRGL
NRLFPKMKKSIKTDKEVDDRLKKKFLNLVPQRRPSRIEAAGRTGKNPENRPRPQKQLSQP
TLGVVELMDSSRLRGSQSSEGPELTHSLSVSSPSNTTYSAEANRDADIVSGGTPTSAPSR
LSDGLQPDPLDGLAFPDSTELYPMEKLQEDDRESDRAHDGTPKAVRRLEALGIGDVQSED
DQGTDSELHNWQQLVGREVLAGLRPQEIKRQEVINELFYTERAHVGMLKVLDDVFYQRLS
KDAILPPADIKNIFTNLEEVLQLHVSILEQMTAIRKRNDLLVIDLRGDDLLSWFSGAEEE
KIKQAVGTFCSNQPFALEIIKTKQKKDSRFTSFIQEAESNRQCRRLQLKDIIPVEMLRLT
KYPLLLDNIVRYTDDPVEKHKVKQAADCCRKILSHVNQALKESEDKQKLEDYQRRLDLSS
LKQTDNPVILELKNLDLTKKTLIHEGPLSWKMNKDKTIELYTLLLEDILVLLQKQDERLI
LKCHSKILAGTPDTKHTFSPIIKLNTVLVRSVATDNKSFFVLSMSDNVAQIYELMAPTVS
DQKTWQTLISQRADTMKVKPHSIIPLPQTDGERDGVEIITAGVSRLSRERDRTSTGSTQS
TDKESGPASRSTLQGSLPAGNPFEEGKADVEEEEGFLDPELSCEVSEVDREGDSFDVFPS
RADEALKTLAALKQVLVNQLMSQEAAQQTKRSTGVRLLRTTSLRTPTDNRAKVMVHNGSE
KSSSKTEDLAQDLGSGDTGFFDSPEDYGCLVLDGYGGQGESSTDGDILASAEGKQLRTSQ
GCAADSGINLRFSSTSQFGSLSTFSRQVLSHLRHLQTSLGYLKEVETKYNNLIRQRTDRP
STDTDGNKDKR
Download sequence
Identical sequences ENSPFOP00000007005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]