SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000007069 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000007069
Domain Number 1 Region: 73-211
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.01e-37
Family Regulator of G-protein signaling, RGS 0.00000463
Further Details:      
 
Domain Number 2 Region: 761-841
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-27
Family DIX domain 0.0000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000007069   Gene: ENSPFOG00000006993   Transcript: ENSPFOT00000007081
Sequence length 842
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519698.1:630259:651800:1 gene:ENSPFOG00000006993 transcript:ENSPFOT00000007081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPLMDHIASSSFREDAPRPPVPGEEGDAPRYPSKAAVMKPLEAPKSALLAGSPGSSAR
RNEDGLGEPEGSASPDSPLSRWTKSLHSLLGDQDGAVLFRTFLEREKSADALDFWFACNG
FRQMDLKDTKTQRVAKAIYKRYIENNSVVAKQLKPPTKTFIRDNIKRQHIDSAMFDQAQT
EIQTDMEENAYQMFLTSDIYLEYVRTGGENPSHVSPGSLGSLKVVCGYLPTLNEEEEWSC
DFRAKALLALKGQRLPITQRAVEMMEKGYRSYKRGEQINPCHAGAFAPVSSTNDSEVSSD
ALTDDAMSVTDSSVDGIPPYKLGSKKQLQREMQRNMRMNSQFSISFSKRTTRPPKEMVPL
EPAQFAAQLISRLENLKRKQDTFNSLEERLQQIQEEEEREDSEISVSAPQLSPHPLALLS
GSSDEDPQAILDEHLSRVLKTPGCQSPTVVQRSPRSSSPENRTYACGGKPRAGSSASPVS
SPDSGAFALSLGSSRTLLSRQSTKHIHHHYIHHHASPKSKEQIEREAALRVQGVCSAAGR
CQSCQAYPRSRSLGREMCGSVSTESNMGRSSSLSRRVCRSGAEEGVADGCMDDCGISQLP
TDTTDPTENVRQWILESKRQSRHKSHSNQGAKKFGGSSTQTHTWGGGGSCGHLRSHQPAQ
PFIQDPAMPPLPPPNTLSQLEEACRRLEEVSTKIPKQSRHSLVSLQREKTHQVTVHAVGS
ALPSPAPLGPPGLTSTCPGLLQSEEYGRCKKVLGGQAACSGETVVTYFFCGEEIPYRRTM
KSHSLTLGHFKEQLRKKGNYRYYFKKASDEFECGAVFEEVSDDGSLLPTYEGKILGKVER
MD
Download sequence
Identical sequences ENSPFOP00000007069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]