SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000007709 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000007709
Domain Number 1 Region: 5-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 1.2e-33
Family Rap30/74 interaction domains 0.0000117
Further Details:      
 
Domain Number 2 Region: 175-240
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.52e-21
Family DNA-binding domain from rap30 0.0000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000007709   Gene: ENSPFOG00000007771   Transcript: ENSPFOT00000007721
Sequence length 254
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519694.1:1896694:1955479:-1 gene:ENSPFOG00000007771 transcript:ENSPFOT00000007721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKKEVNLSGLRQNKGVWLVKVPKYLSQQWEKVTEKGEVGKISIEKKQGKTEVCFTLNE
ELAAMTAAGEKEESLQAPREYPFTMHTVGAQTMVVFSQADADEVSLEGTVVHRAECRPVV
SDSYMKVKRLQVKSVKPQRLVQQLDRAVATVFKPVANHDFNLEYEKKKKSDGKMVRADRQ
LVLDLLFSAFEKHQYYSFKDLVDITKQPVTYLKEIMREIGVCNRKGVHKSTWELKPEYRH
HQPSEEEEQKSPSS
Download sequence
Identical sequences ENSPFOP00000007709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]