SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000008370 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000008370
Domain Number 1 Region: 191-531
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-80
Family Protein kinases, catalytic subunit 0.00000098
Further Details:      
 
Domain Number 2 Region: 37-185
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.35e-33
Family Regulator of G-protein signaling, RGS 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000008370   Gene: ENSPFOG00000008341   Transcript: ENSPFOT00000008382
Sequence length 560
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519755.1:683744:692102:1 gene:ENSPFOG00000008341 transcript:ENSPFOT00000008382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMDIGGLETVVANSAYVSARGGADGCAAAAMRDKKMRARLKLPHIRDCQHMKTTVDTTFE
SMCTKQPIGKRLFQQFLQSSATYKDAGDLWKDIEDYGISQENDRLQKARRMVNTYYETAS
KHFCSFLEEKAVIRVKEDLKNVRADLFKESEQQLLQHLEKKALDEFKSSKFFLRFVQFKW
LESQPFDEEWFMDFRVLGKGGFGEVFACQAKATGKMYANKKLEKKRLKKRKGYEGAMVEK
RILAKVHSRFIVTLAYAFQTKIDLCLVMTIMNGGDLRFHMYNVDENNPGFDEKRARFYTA
QIICGLEHLHQHRIIYRDLKPENVLLDDAGHVRLSDLGLAVELPPGKDKTTGFAGTPGFM
APELLQKVDYDYTVDYFTLGVTVYEMIAAKGPFRVRGEKVENDEVARRTLNDPVSYPPSF
SKESKDLCEGLMEKDPAKRLGFKDNGCTELKNQPFFKEINWGRLEAGMLLPPFVPDPKMV
YAKDIDEVGVFSTIKGVALDDKDAEFYSDFASGNIPIPWQEEMIETGVFGEMNVWGEGGK
LPNNLDPNYVEAKGGACVLL
Download sequence
Identical sequences ENSPFOP00000008370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]