SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000009210 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000009210
Domain Number 1 Region: 384-476
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-17
Family I set domains 0.02
Further Details:      
 
Domain Number 2 Region: 470-558
Classification Level Classification E-value
Superfamily Immunoglobulin 1.5e-16
Family V set domains (antibody variable domain-like) 0.09
Further Details:      
 
Domain Number 3 Region: 318-389
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000193
Family I set domains 0.0061
Further Details:      
 
Domain Number 4 Region: 29-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000279
Family V set domains (antibody variable domain-like) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000009210
Domain Number - Region: 153-197
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0016
Family C1 set domains (antibody constant domain-like) 0.05
Further Details:      
 
Domain Number - Region: 233-280
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00975
Family I set domains 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000009210   Gene: ENSPFOG00000009234   Transcript: ENSPFOT00000009222
Sequence length 592
Comment pep:novel scaffold:PoeFor_5.1.2:KI519998.1:36264:45697:-1 gene:ENSPFOG00000009234 transcript:ENSPFOT00000009222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAMSLSAAASLFLLFLFCEVEQTYSSWGVTYGSQYICALKGSTVRMSCMYRHPSQEGNIK
ISVTQTFWFAKTDEGPVDVKTQEEYADRLEYSSSKKNCTLTIRDVKESDSAVYKFRFITS
RSGGSYTGEPGVVLIVTDSDPNLTVRKKSSSWNSNLICSSSCVLPDHSTYVWYKNGKDME
IGTYVYNTWVDSDDTLSCALKGREDFPSPLFFYIKVKFVIPDLQVEVTRTSTNQDPQYAE
LKCHSRCTPAGYHYYRWFRNGQDIGHSKSTYKVLINTTDRISCSVLSFKEHKAPEPFSII
TQYAPVLTSVSADPSDGIVEGNRVFLKCSSDANPPANYTWYKKTKIKDSEFYLNPIQASD
SGEYFCVAKNQLGESRSGNLNIDVKYAPKRADVSLSHAEIVEGDSVNLTCSSDGNPAPFN
RWYKDNQMMLQGQGGVYQFTSVKSEDSGTYCCEVGNIYGQINSSTVLINVEYSPRLPSVS
VNPPGDVAAGSSVNLTCSSAANPAATYAWYKEDSTSPAADGQTFTIVDIRGEHGGNYYCQ
ARNSRGHHNSTLHLIVVSNAHVHLNHNDVVCHALVGVLRVFTLLFLLLVLYQ
Download sequence
Identical sequences ENSPFOP00000009210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]