SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000010503 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000010503
Domain Number 1 Region: 184-526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.47e-86
Family Protein kinases, catalytic subunit 0.000000279
Further Details:      
 
Domain Number 2 Region: 32-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.63e-43
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000010503   Gene: ENSPFOG00000010254   Transcript: ENSPFOT00000010518
Sequence length 575
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519787.1:230782:277582:-1 gene:ENSPFOG00000010254 transcript:ENSPFOT00000010518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDLEEIYKNEVQLKNNLGGGGNRKGKSKKWKQMLQFPHISLCEELRQTTEKDYSSLCERQ
PIGRLLFRQFCDTRPELRRCVKFLDAVAEYEVTPDEKRKECGQELIDRYFNPKSGNYVSE
VEAAMMTQCTERLQQEACKELFKDCTKLIHDYLSVAPFADYLDSMYFNRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGEAGFDERRAVFYAAEICCGLE
DLHRERIVYRDLKPENILLDDHGHIRISDLGLAIRVPDGETIKGRVGTVGYMAPEVVMNE
RYTFSPDWWALGCLLYEMIEGQSPFQQRKKKIKREEVERLVKEVQEEYSNKFSEEARSIC
KMLLAKDPTKRLGSLGGGASEVKGHPIFRPINFKRLEAGMLQPPFIPDPQAIYAKDVLDI
EQFSTVKGVELDPKDESFYSKVSTGSVSIPWQNEMIETECFSELNVFYEDGAVPPDLDWR
GQPTPTPKQGLLQRLFGRQDCCGNCSDSDDEPTRL
Download sequence
Identical sequences A0A096MC53
ENSPFOP00000010503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]