SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011014 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011014
Domain Number 1 Region: 536-659
Classification Level Classification E-value
Superfamily PX domain 1.31e-21
Family PX domain 0.0028
Further Details:      
 
Domain Number 2 Region: 314-462
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.02e-19
Family Regulator of G-protein signaling, RGS 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011014   Gene: ENSPFOG00000010369   Transcript: ENSPFOT00000011030
Sequence length 920
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520238.1:46102:55409:-1 gene:ENSPFOG00000010369 transcript:ENSPFOT00000011030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSWRRYMEVLVRGVKVLREAGRQYPLSCSLLLVLLGLTVLLHRFLHVFLMFWSLLAGFV
TFYFSLGPDSLLPNVFFPVKPRAKHQDPELFPLGHSCAVCGTTRCQRHRPALLLENQQPW
LDLRVHSKVDASVAEVFELVLEKFVYPWYRDITEDDACLDEVRTTFRFFSSVLIRRAQKV
DLPSVFADKVMKAAMKHLEIVAKARARAKRWEDLQQAALDGYGASLHAALRSRRDELRYL
RMLTDTLLPYLTPPKTTDCRSLALLLREVMAGSVFLPTMDFMADPDTVNLMVLLFVDDTP
VGGAVPFLQRYSSSSQRPSVLQLQLKAIRSQQDLLFRFLNFLKQEGAVHVLQFCLAVEEF
NERILSPDLSDPELKRLHDEVLHIYRTFCRDDSADKIRFDPAVVEGIRSVVVAPYSQVVA
LQKKPFLFQAYELVLSLLEEVFTPMFCHSDEYFRHLLRGSESPTRNARINRNPSRRGEVF
GISRIGNRIKGVFRSSTMEGGLLPAGADPDDDSVEEATVVLEDDGAVEPLAAPHQRLLSA
WSVSLPFIDFCEDEAKREKVPVFVIDVKRNDRRDAGHDPESWTVCRRYLEFYVLESKLTE
FHGTFSDVQLPSKRLIGPKNYEFLESKREEFEEYLQRLLLLPELSNSQLLADFLSPFSLE
SQFLDKMLPDVNLGKIFKSVPGKLMKEKGQNLEPFIQSFFNSCESPKPKPSRPELTVFSP
SAENKKLFNDLFRNNADLSDAPERKHNSNCFLEVVAVDGMYDYLMYVGRVLFRVPDWLHH
VLAAGRILFKNSLEAYVDRYLRSKLEAVLQEHRLVSLITQLRDAVFCENHQDRSPKEKLL
RAKQTFDEMMRYLPDAVVKLIGEERQRDGIELLFHALQQPLLNKQMTYVLLDIAILELFP
ELNQVMGPMRAEPPSGTEPV
Download sequence
Identical sequences ENSPFOP00000011014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]