SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011246 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011246
Domain Number 1 Region: 1265-1379
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000147
Family Regulator of G-protein signaling, RGS 0.0039
Further Details:      
 
Domain Number 2 Region: 1096-1226
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000162
Family Regulator of G-protein signaling, RGS 0.004
Further Details:      
 
Domain Number 3 Region: 918-1015
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000113
Family Regulator of G-protein signaling, RGS 0.0059
Further Details:      
 
Domain Number 4 Region: 189-223
Classification Level Classification E-value
Superfamily F-box domain 0.00000114
Family F-box domain 0.0072
Further Details:      
 
Domain Number 5 Region: 665-760
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000559
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011246   Gene: ENSPFOG00000011211   Transcript: ENSPFOT00000011262
Sequence length 1416
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519646.1:2173632:2200714:1 gene:ENSPFOG00000011211 transcript:ENSPFOT00000011262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVNEDSGFSSLTLDKSQDSSDHDGSFQELLISASKGTGRTLTLTDVKRRSRLHRQHRLST
LKEGGSQSEEDQANRKHEDPSKCSSHSTDDVFADATPCSTMSARCFNNLVSVNLSLTPAL
QLVHAMCQYKFQKSAGQSPSLKEELKFTAALAKTAMMFRTSMPLAGLIGRKMGLRKLDIL
TELKKRNLRHILANMFSKLNSECLYRCSLVCRSWNEIIEQDHQASLRRRIHLGELEDLQY
GVGVLQISEGETRSALSKRSALKKIQAQSRTSSYCTPQSANNTLATPQHGTLSTGSSIKR
DKFLEKSYLASDDVLVYYFNEFLSLPSFSEALVYNQQSGLFEVATEKADIVAKQIRATLK
QYKSLLLSDDLETFSKMPPVPDICFTVTSNVSLQCLSREEGTRWITEKRLPFFLQSDFYH
EYRRSNLGDSKALTLRGLSFKNNFFSGKFLRSQNFLQIFDFVNSETLIMIKSSLYQVKAV
INMATFSWFLKLAKLLFQWKPTFWSLDWKNWSDEKDISSYAISELLDYSSSEEDSSDSLE
SISPEPGRFLDLILLRDQQGLQQMFLTLRSPVHLILTQKHIHFLFSSLSYNLTAEEQPAY
FASKVVGGQPDLSRTDDQHEAKKEKTKLARKKSTPLNSAKDSRNKQAEVKKSPILCWQAS
SADENRPGLDEFKEFLRGTSGEKLLNLWMDVQTLIALQTEEYLVLLRNCYLRSSSPCCLN
GELLARLGLTNSPCWTEEKLFSVQELLTEPLLSYWCGPQFRQPGSHSEEYLSPFHHSGRP
HVISLGAYSEPGCSNLFKHGPKPCYKTQLKSTPGPKNKLKNEVIKKYFNKIQKIVRFSFV
GKEGVNQSNFKRVSHAFLIERDTTILLIYLGLDPIFYQEITYTVVYIFPKMSAKCETPFG
RRVKPMMTSLFIEFRTGLYFTHYCEQSGNKIIWTCTLSYIFILGLYRLMEIYTXMDPYSV
QREAQVLYSTYISSFARRSINVKTEIRREVYNKLQPAFEELFDRVEEHVLDILLEPWTQL
NQRDKESFQQVPVHEEQRYFFNTEYRELLRLCKESKEHQKRISKQQQYGKIIEFSDVTLI
RNAGLWSKVAAVFRGYRLLTLLRQPQEIGHFMTSLKENDASIHLSCWLDLERYKVISKTD
KSFRQEKSTMIVKKYLNEDYFFGPGSPATEKQQKDILVKAGGEEKLQSETLSNRVAIAIQ
EIIQPYLEETWMPVFLSSKEFVERHKERANTKDEIQTLLLQSCHRPHGVQTKLEASQMST
SRDILLFRRALLNPSTCKQFQDYVSVKGELLENDVRFWVEVQRYKDLCHSHSSMVIIQHK
ISTIINCFINSSIPPSVQINISHDQARRILERRRELGPYIFREAQIAVFSELLKLWPKFQ
VLSRNLSKAKLIPLLQEKRAKHRAKIRKQRRLEEEE
Download sequence
Identical sequences A0A087XZP3
ENSPFOP00000011246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]