SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011569 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011569
Domain Number 1 Region: 30-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.01e-17
Family Linker histone H1/H5 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011569   Gene: ENSPFOG00000011596   Transcript: ENSPFOT00000011585
Sequence length 212
Comment pep:novel scaffold:PoeFor_5.1.2:KI519683.1:2304448:2307268:-1 gene:ENSPFOG00000011596 transcript:ENSPFOT00000011585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEAPAAAPAKAPAKAPKKKSAPRPKKDGPSLPKLIVDAVAESKERKGMSLAALKKVLA
GKGVDVSKANKRINTAVTKLVTKGTLSQTKGTGASGSFKLAKKEPKAAKPAKKVVKKKAP
VKAKKPAAKKSAAAKKPAAKKPAAAAKKSPKKAPAKKAAKKKKPKAAAKKSPAKKPAAKK
AAAKKAKKNISKLSEYTKVYVSFLLERAHSEK
Download sequence
Identical sequences ENSPFOP00000011569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]