SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011602 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011602
Domain Number 1 Region: 186-522
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.68e-75
Family Protein kinases, catalytic subunit 0.0000032
Further Details:      
 
Domain Number 2 Region: 33-179
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.05e-27
Family Regulator of G-protein signaling, RGS 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011602   Gene: ENSPFOG00000011569   Transcript: ENSPFOT00000011618
Sequence length 548
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519765.1:1477911:1483689:-1 gene:ENSPFOG00000011569 transcript:ENSPFOT00000011618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDLAGLVSLVANTAYLGALEPDSNELRMRRVSLTLPTPKKSSAPRAALEKTYESLCEQQ
PIGRKLFQQFLLTSDSQCVAVAEFLEELSNWSVAEDGTKEKAKQRILSKFCQPQSQTFLS
FLTAEDVKACLSLFNKNDEAAVEQMREATRKFLKGKPFLEYMKSPFFYRFLQWKECERQK
ITDRYFYEFRSLGRGGFGEVCAVQVKHTGQMYACKKLDKKRLKKKGGERLALTEKQILEK
VNSTFIVNLAYAYQSKTHLCLVMTLMSGGDLRFHIYELGRRGIRMERVVYYAAQIVSGIL
HLHSMDIVYRDLKPENVLLDAKGQCRLSDLGLAVELPKGKMTCQRAGTTGYMAPEILKQE
YYRTSVDWWALGCSIYEMVAGRLPFKDFREKVQNSEVTRRTLEDDCKFEDKSFDGPAKDI
INHFLKKKVLFRLGCRFNLIDDDPRTHTFFKNINFHRLEAGLVEPPWVPKPTVVYSKDSE
DFRDNSEIKDVKFDSKDEKFFKEFSTGAVSVCWQREIIDSGVFDEVNNPGVNGHGQENVW
TSRMCIIL
Download sequence
Identical sequences ENSPFOP00000011602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]