SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000012631 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000012631
Domain Number 1 Region: 101-238
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-38
Family Regulator of G-protein signaling, RGS 0.000000674
Further Details:      
 
Domain Number 2 Region: 814-894
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.2e-27
Family DIX domain 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000012631   Gene: ENSPFOG00000012489   Transcript: ENSPFOT00000012648
Sequence length 894
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519642.1:2409597:2430145:-1 gene:ENSPFOG00000012489 transcript:ENSPFOT00000012648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVVRDLHGVGYRGGGGVVASLNGPAHFTEDAPRPPVPGEEGTDLDPPVQSGNSRPGGLS
QTQGYPSSKMGDPSSHVPSSSSSATPRRPDLDLGYEPEGSASPTPPYLKWAESLHSLLDD
QDGTNLFRSFLCQEGCEDLVDFWFACSGFRQTSQDKRAKLAKVIYRKYIVDGSGIVSRTI
KAATKSFIRDCVGKPHLDPAMFEQAQTEIQAMMEENTYPLFLKSDLYLEYTRTGGESPKP
NPSDQSPSSGPAKPPPGYLPTLAEDVEWSCNQGGVREEEEEKDEEDCGDTPVSRLTQSLL
MQTAPQRASPSRRRQDSREYRYIPWREPVNPYYANMGYARAPVTSANDSEQQSMSSDADT
MSLTDSSVDGIPPYRYRKQHRKEMHESAKANGRVPLPHIPRTYRIPKDIHVKPEMFAAEL
INRLEAVLREREAQEKLEERLKRVRLEEEGDDADISMTTSMSSHSIPLPIPSSFPPLYGA
RYSETTANTGTATTYGGLVAMEDPHEDDPESILDEHVQRVMKTPGCQSPGATNSSLGGGG
RHTPPKSSRSPDGGIGPPHYPSHRGGGQSLPTVGAKGIYHHKQVYHHRGRDGQEETGGRP
PPNLLWNGDQTNQYGGRRNYADGAGASTLEGMGYGSKGSTMSRRGFKKTEIPSKGDESGR
GLETQGYPGTQVEDLERNQKILQWMMDGDRQRKSSHGGSTSSSRRTGTSTESPRPTSVER
PGAVHPWVSAQLRNNVQPSHPFIQDPAMPPNPAPNPLTQLEEARRRLEEERRRAALLQAK
QKYGLSFCVNFRFSVSSPTLSVRHKSGKRQVCENMTVAYYFCGEPIPYRTSVKGRVVTLG
QFKELLTKKGHYRFYFKKVSDEFDCGVVFEEVRDDDAILPIFEEKIVGKVEKVD
Download sequence
Identical sequences ENSPFOP00000012631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]