SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000013249 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000013249
Domain Number 1 Region: 4-148
Classification Level Classification E-value
Superfamily EF-hand 6.48e-32
Family Calmodulin-like 0.00000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000013249   Gene: ENSPFOG00000013229   Transcript: ENSPFOT00000013267
Sequence length 150
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519820.1:12946:15836:-1 gene:ENSPFOG00000013229 transcript:ENSPFOT00000013267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEFTPDQIEDFKEAFGLFDRIGDSQVAYNQVADIMRALGQNPTNKDVIKILGNPSAEDM
ANKRLNFDAFLPMLKEVDALPKGSYDDYVEGLRVFDKEGNGTVMGAELRIVLSTLGEKMN
ETEIDSLMAGQEDENGTIHYEAFVKHILSV
Download sequence
Identical sequences A0A087Y5E6
XP_007567660.2.10163 ENSPFOP00000013249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]