SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000013539 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000013539
Domain Number 1 Region: 348-432
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-29
Family Forkhead DNA-binding domain 0.0000146
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000013539
Domain Number - Region: 195-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.047
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000013539   Gene: ENSPFOG00000013505   Transcript: ENSPFOT00000013558
Sequence length 464
Comment pep:novel scaffold:PoeFor_5.1.2:KI519627.1:2871691:2886276:-1 gene:ENSPFOG00000013505 transcript:ENSPFOT00000013558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLTSPAYQKQINMSCYAQEYFVLASQLVKIVLSFGQSLVFRQQHLKEFYQQQLQQQTSK
KVKELEIMFLSGRESVERVKIIFQEMLLISYQKHQLMFQQKPAASPPGLSSGSVIRTKTI
CADLTGYFGPAEMQKLWKELRSALSDDGAAMSGNQKTSARVEPTGDRLSESPPGAERSGA
DRDPALARALFGPGVCNWPGCESVCENIAQFVQHMSSEHTLDDRSTAQCRVQMQVVQQLE
LQLCKEQERLHVMMAHLRLPSPCAQSVKPPPDVLQFGVICKESSLSFQLRPTPLAGKASL
SLRHQRPLSAAGSPPQGHERAVAGHRHHPLVFSLSSENEYELYQNTDIRPPFTYAALIRQ
AITEASDMQLTLNEIYNWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTV
DEEEYQRRRSQKIAGSPSLMKNVCSSLSLGTALHSTFQAALAEA
Download sequence
Identical sequences A0A087Y686
ENSPFOP00000013539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]