SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000014240 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000014240
Domain Number 1 Region: 288-420
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.67e-43
Family Regulator of G-protein signaling, RGS 0.000000827
Further Details:      
 
Domain Number 2 Region: 17-125
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-26
Family DEP domain 0.0087
Further Details:      
 
Domain Number 3 Region: 224-280
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000000772
Family Transducin (heterotrimeric G protein), gamma chain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000014240   Gene: ENSPFOG00000014189   Transcript: ENSPFOT00000014260
Sequence length 657
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519617.1:1635552:1653885:1 gene:ENSPFOG00000014189 transcript:ENSPFOT00000014260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIRNALRDHGQRYRPRMACLKKAEKVLLEMQDPCTGVKSQPQRLVITIIPHAITGEDII
AWLADRFQIDAQEARSFGSMLVALGYIYPLQDHKRLVIKPDASLYRFQTPYFWPTQQWPV
EDTDYAIYLAKRNIRKKGILELHEQEQYNHLHKWMNHKWDFVVMQAKEQYRAAKERKKPD
RVVFDCQERAYWVVHRPPPGTVSAMDYGLDRRTDPNTDETQTPDYYERIMIFTQQSIMRP
RVKSSVSIGALVKYSATYSGHDPFLSKCLPSNPWLTDDTTYWTLNMSNVEIPTKMRVERW
TFSFKELLSDPRGRDDFRLFLKKEFSGENLAFWEGCEDLKWGTAVAMREKAEQIYKTFLA
RGAPRWINIDGKTMEITVKGLKHPHRYVLDAAQTHIYMLMKKDSYGRYLKSPVFKETLKK
AICPEEHKFNEVQLEQNARNRRPSLSPIIIRQQEQEQRAKMAANAPVDITQLCRFTTPVP
HLAVYTGIPDPPSVTASPSLPFLAHTPVCPSPISVALDSTSASERRMEASDGEGNTEVRA
PEGGNLSKSRMALSLRRLLKRGCSPSTMFASLSPKCHTAATTSSRIQPITPDEASQAPPR
RIGNFFQIKVDIPPECRIYPIESEDEDEENRPASRDAVGTEEIICPWESLTRQNGTG
Download sequence
Identical sequences A0A087Y887
XP_007571308.1.10163 XP_014861053.1.96476 ENSPFOP00000014240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]