SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000014469 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000014469
Domain Number 1 Region: 751-899
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-37
Family Regulator of G-protein signaling, RGS 0.0000737
Further Details:      
 
Domain Number 2 Region: 1085-1175
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.6e-28
Family Ras-binding domain, RBD 0.00086
Further Details:      
 
Domain Number 3 Region: 241-383
Classification Level Classification E-value
Superfamily PH domain-like 1.09e-20
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 
Domain Number 4 Region: 4-82
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.0093
Further Details:      
 
Domain Number 5 Region: 1031-1099
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000279
Family Ras-binding domain, RBD 0.058
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000014469
Domain Number - Region: 497-505
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0157
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000014469   Gene: ENSPFOG00000014314   Transcript: ENSPFOT00000014491
Sequence length 1610
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519621.1:1873777:1929611:1 gene:ENSPFOG00000014314 transcript:ENSPFOT00000014491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIQAVEVARGRTGYGFTLTGQSPCVLSCILKGSPADYVGLRSGDCILSVNDINVSKASHE
DVVKLIGRCSGILKLVIAEGERHRRHPDSCSSDDELDVFYNNGCGPKGGWYKPKVDSKQL
GINRAEKVVAELQSGGIFNMIFENSSHSSSSSDKDRPGVSSSSKPHQMSDPEFNPYRSAS
CTQSNPNLLSEEEMAQVLNDDSVFLESDFRHLHIHHHEEQDMDVGEGADFGLEPSEGILN
VGMIVGYLGSIELASTGTNLENDSLQAIRGSMRRLRAEQKIHSLVLMKVMHDSVLLCSDR
GQVLATYPAEKLAFSACCPDDRRFFGLVTMQATDDHDDRHFSNGRDDEGSLRTSCHVFIV
DPELCHHQVHSGVARRFGFECTPDPDTGGCLEFPPSSQPLLQFVSVLYRDMGDNIEGVRA
RAFHDPDNDAQQNHSTSSNSDSGIGNFLPEEKSNRVLLVDLGGPPSHNHMSGARQWDSPP
SSQQAWSPILGAAASHPPPPPPPPPMLRNGHYLHDPHLADLPHPLPLAHPDLPSRLSQGL
NVHHYPARKLGGAMVEPQRWLPVHVLRDWRQQHQQHQHHHSHFQGLSSDQESYAESTDGW
SSANCSTLPPPMNKIPADRYRAPLAPGDRMHPPGVSHPHLHSHRLAAQKDEWAKKLFGAG
DRERSGARRAEKEKKREANSKEGEKKGGRFRGLTMGFPPLPHRSSARRSFGRSKRLSMAR
SLDNLESAAVSDGELNSVELQGCSSDNSLNSNASLPSVQSHRRHTERRVASWAVCFERLL
QDPVGVRYFSEFLKKEFSEENILFWQACEFFSHVSENDNKQLSQRAREIYNSFLSSKATT
PVNIDSQAQLADDILNAPKPDMFKEQQLQIFNLMKFDSYTRFLKSRLYQECMLAEVEGRP
LPDPYHIPSSPTSKHSTTGSDRSNLSTPKKVEDKKTKSGRSLNEDSRDDSGDRRKGMFFS
WSRNRSFGKGPKKRELADFNYICVFSGTNGRRESQGSLSSGASLELGTSGSGKNEAGQTH
ERGGGSAPLRQCNISLPDGSCCPVPLRPGMSIRDLLQGLCDKLCINLAAIDLFLVGGEKP
LVLDQDCMTLSSRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLHLS
DLVARISGESEPLDLGLPISNLDGLRVVLDTEENAMGKVLFPHTDKIKAAQSHLPASASR
NQSATGDDRPTRKGGSAHPHGAPGKRKQKKINIDEAEEFFDLISKAQSNRADDQRGLLNK
SDLQLPDFLRLTPTSPTTPAPLNAEPICSTPNSRNTDNGGFPSSSHRGNKGNGNHRGGVV
SGSYLLSASHQSQSLDSALGAECGGGRKTRPPPPFPATVSPIQSTRPSAQGLLQDSARGE
SIQMLEEDALSDLTLVGEGDINSPSLNYITPSSLSSKPLPRPQHEAQDCLKIHTTSVKDQ
DHRASLQTVEWSGKDRAGWRGREKGGGGGGGGLKTTSRRTASLNPIPSSPPSPPPRPPLR
SRRKSKSPSSRYNHTAPKQALDVDKIGGGSKSEDLRKTRNGSRDLRGQHISELDRKWEGV
ALELQCRGSRMRSAVYQTSDLPSMVKAKKQLDQGYSRGQIDRSKLKATFV
Download sequence
Identical sequences ENSPFOP00000014469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]