SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015092 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015092
Domain Number 1 Region: 288-417
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.62e-38
Family Regulator of G-protein signaling, RGS 0.00000171
Further Details:      
 
Domain Number 2 Region: 15-118
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.16e-25
Family DEP domain 0.0069
Further Details:      
 
Domain Number 3 Region: 223-278
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000327
Family Transducin (heterotrimeric G protein), gamma chain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015092   Gene: ENSPFOG00000014989   Transcript: ENSPFOT00000015114
Sequence length 481
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519830.1:690094:709805:-1 gene:ENSPFOG00000014989 transcript:ENSPFOT00000015114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIRTARPNRGQRFRPRTHCLKKLDAIVVEMQDPKNGVKGSEQKLNVTTIPHAITGANIT
AWICNKMKTSTEEAQVFGTMLVAYGYIYPLQNHRKLVMCNDSSLYRFQTPYFWPSQQWVP
EDSDYAIYLAKRNIRKKGMLEPYEQVDYNHLHEWLNHKWDFIVMQATEQYKAGRDRNKAD
RVVFDCQERAFWIVNRPPRRTHSALDVGPERLINPNVEEKITFDQYRRVNIFYQQAIMRS
KVKSSVSLGALVKYITSYKNHDAFLAPCLPSNPWETDHDAYWTLNMRRVDVPTKMRVERW
SFSLFELLTDLRGRDDFKIFLKKEFSGENLAFWEAAEELKWGTASSMSAKAESIFKTFLA
PGAPRWINIDGRTMGLTVKGLEHPHRYVLEAAQTHVFMLMKKDTFFRYLKSPTYKEIQKK
ALSPEAHNFSPAQLEENARNRSAGIHPIILWQQEEEEKAKAAAASAPVDVKAVMSKIDRK
K
Download sequence
Identical sequences A0A087YAN9
ENSPFOP00000015092 XP_007568366.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]