SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015131 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015131
Domain Number 1 Region: 189-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-82
Family Protein kinases, catalytic subunit 0.000000777
Further Details:      
 
Domain Number 2 Region: 38-185
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.56e-39
Family Regulator of G-protein signaling, RGS 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015131   Gene: ENSPFOG00000015075   Transcript: ENSPFOT00000015153
Sequence length 561
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519680.1:1025464:1032272:1 gene:ENSPFOG00000015075 transcript:ENSPFOT00000015153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIGGLTTVVANSAYINARGSIDGSNPAAARDKKYHARLKLPHITICEGLRDTLDLAFDS
VCVEQPIGKRLFREFLEANKEYHGACRLWKDIEDYDLAEDSDRGKKASKIVQRYMDPSAK
HFCPYLPEDIIAKVKENLEAVGDDLFSASLAKTLEYLREAPYTFYLESMYLKRFLQWKWL
EMQPMDADWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKRLKKRKGYEGAMVEKR
ILEKVHSRFIVSLAYAFQTKDELCLVMTIMNGGDLKYHVYLVDENNPGFDEPRACFYIAQ
IIQGLEHLHQKRIIYRDLKPENVLLDNDGNVRISDLGLAVELKEGKTMTKGYAGTPGYMA
PEMLKGDKYDSSVDYFTLGVTLYEFIAAKNPFRNRGEKVEREEMKERMLNRVVTYTDNFS
EHAKSLCDGLLAKEVDQRMGFKNECCDEIRAHPFFKDINWRKLNAGILPPPFVPDPKVVY
AKDLDDVGAFSSVRGVALEDPDKTFFDEFATGNISIPWQEEMIDMGIYGELNLWGPEGTI
PNDLRRESILEQPKSSTCCIS
Download sequence
Identical sequences A0A087YAS8
XP_007555500.1.10163 XP_014901008.1.100837 ENSPFOP00000015131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]