SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015292 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015292
Domain Number 1 Region: 131-216
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.07e-31
Family Forkhead DNA-binding domain 0.00000914
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015292   Gene: ENSPFOG00000015252   Transcript: ENSPFOT00000015314
Sequence length 607
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519741.1:259940:270096:-1 gene:ENSPFOG00000015252 transcript:ENSPFOT00000015314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAPLSCDEPPPNVEIDPDFEPQKRPRSCTWPLPRPESGAGKPGANDADVIPEEEDDEG
GSAENCSVQKNGDSVNEPSGGGRGSVSQPVELQGGPRKDEAADGSPSSAQIPGAALCGSA
SQQLRKSSARRNAWGNYSYADLITQAIESSPEKRLTLSQIYDWMVRSVPYFKDRGDSNSS
AGWKNSIRHNLSLHSRFVKVQNEGTGKSSWWIVNPEGGKGGKAPRRRAVSMDNSKYIKGA
RGRATKKKASLQAAQDGSSESSSSLSKWTGSPTSRSSDELDAWTDFRSRTNSNASTLSGR
LSPILANLELDEVPDDDSPLSPMLYSSPSSMSPSTGPTGLPDLAGTMNLNDGLSDNLMDN
LLDNISLTATQQPPPGEEDPGAISQGGSVFTFSCTGSPSGGYGSNPLFSPTSITSLRQSP
MQTIQENKQTTFTSISHFSDHQDLLSLDSPSHNNVLLTQSDPLMSQASTAIALQNSRRNA
MLLRKDPMMANLSGVGQSASVPGWQAGLPTPDNDGGGHANSKPPHLKSPGKNATMQDRFP
GDLDLDVFNDSLEYDMDSIIRNELMEADCLDLSFDVRLDSTSTQNGNRNSGSFSGAKQTS
PQNWVPS
Download sequence
Identical sequences A0A087YB89
XP_007561860.1.10163 ENSPFOP00000015292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]