SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000016163 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000016163
Domain Number 1 Region: 9-108
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 7.93e-30
Family MHC antigen-recognition domain 0.00069
Further Details:      
 
Domain Number 2 Region: 116-205
Classification Level Classification E-value
Superfamily Immunoglobulin 4.94e-27
Family C1 set domains (antibody constant domain-like) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000016163   Gene: ENSPFOG00000016082   Transcript: ENSPFOT00000016185
Sequence length 249
Comment pep:novel scaffold:PoeFor_5.1.2:KI520170.1:172078:175420:-1 gene:ENSPFOG00000016082 transcript:ENSPFOT00000016185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RALATSCDQLCFIWFSFPDGFEVHSVFRCLFNSTELKDTQYIYSYIYNKVEFLRFDSNIG
LYVGYTSFGMRQAENLNNNPVALSSRRAQKEVFCHHNSGVWYRNILNRSVAPSVTLSSAA
PPAGGHPAMLTCSVYGFYPKQIRVTWMRDGQEVTSDVTSTAELPDGAWLYQMHSSLEFKP
RSGERISCRVEHASLKEPLVTDWDPSMPDSERNKLAIGASGLILGLILSLAGFIYYKRKA
RDRIRTRTN
Download sequence
Identical sequences ENSPFOP00000016163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]