SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000016317 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000016317
Domain Number 1 Region: 184-535
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.47e-83
Family Protein kinases, catalytic subunit 0.000000519
Further Details:      
 
Domain Number 2 Region: 32-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.8e-39
Family Regulator of G-protein signaling, RGS 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000016317   Gene: ENSPFOG00000016056   Transcript: ENSPFOT00000016339
Sequence length 585
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519615.1:5072020:5088588:1 gene:ENSPFOG00000016056 transcript:ENSPFOT00000016339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWFQDLVRNPTFREASEGGGGKRKGRSKKWKEILRFPHISQCAELGKIIAERDYASICDK
QPIGRLLFRLYCETKPNLQRCIQLLDATEDYEVTPDEKRKSRGEQIIKTFLSKQSPQRVD
IAEVFAEQCRENLELSPCKEIFSDCRKAVHEYLSGAPYSDYQNSMYFDRFLQWKMLERQP
ITKDTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNMGTPGFDKDRVQFYAAQICCGLE
HLHRESIVYRDLKPENILLDDNGHIRISDLGLAIKVPEGELIRGRVGTVGYMAPEVINNE
KYAMSPDWWGLGCLVYEMTAGRSPFRARKERVKREEVERRVQEEEEEYNDKFTEDAKAIC
RMLLTKDPKQRLGCNADGAAGVKAHSFFKNINFKRMEAGIVDPPFVPDPRAVYCKDVLDI
EQFSTVKGVNLDQTDNDFYSKFATGCVPIPWQNEMIETECFRDLNVFGPQGTRPPDLDWN
QPPEPPRRSLLDRIFRRHHPDVSISNSRVQSSSVNSVDSMSNSAP
Download sequence
Identical sequences A0A096M7Y1
ENSPFOP00000016317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]